DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and rpk

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001246909.1 Gene:rpk / 40580 FlyBaseID:FBgn0022981 Length:568 Species:Drosophila melanogaster


Alignment Length:500 Identity:108/500 - (21%)
Similarity:178/500 - (35%) Gaps:174/500 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 WNSTFPAITVCEIYNAERIWDLSDSNFGVEHDMHVDDFISEIVFYRGVCSSCED--CSRMRCPSN 106
            ||..|||:|||.  ..:|:......      :....|..|:.         .||  .||:..|.|
  Fly   103 WNIPFPAVTVCS--ETKRVLKQKGK------ETTYADLYSQF---------SEDMRASRVFRPEN 150

  Fly   107 FTHL-VDVFRTKCH----QLLVN-----------------------------CTYLNKLFDCCDQ 137
            .:.| ::.|||..|    |::..                             |.:|::..:|...
  Fly   151 VSALEMEEFRTLLHVCNTQIIEEDIPLIAGDDLDYFDVLQRMLPQFDRYFFYCRWLSRFGECETF 215

  Fly   138 FLPLPTEYGLCFSFNSHQARKV----------------------SHLQFT--------NNRMTGP 172
            |....||.|:|::||..:|.::                      .|..:|        ::..|.|
  Fly   216 FRKTLTEEGICYTFNGLRATEIYRDDTYQYQHSGEPLEMENISSQHTAWTLETGYALDSDVETFP 280

  Fly   173 GHL--------------SFHAAADI---------------QLYVHAPIDVPYQFSEGMIRETVLL 208
            ..:              ||....|.               .:.:|||.||| |.|:..:|  :.:
  Fly   281 ARVLSAGARSGIFLALQSFKQEVDYACRGPVQGFKVGKFENVLLHAPDDVP-QVSKQFVR--IPM 342

  Fly   209 GHYKELIL----NVIEVHNDESVQDLSMEQRRCRYGHEHVPERQGIYDFYSYSGCVVECTVLLQL 269
            |  ||:::    |:|.:  ...:.:....:|:|...||   .....:..|:.|.|.:||.....|
  Fly   343 G--KEVLIAVKPNMITM--SSGIAEYHPVRRQCFLSHE---RSLRFFKVYTESNCQLECLANFTL 400

  Fly   270 DNCNCTSHFMAIPGQNYLPVCDVRGLICLTRI-RDKIMTERK-----------------SCECMS 316
            ..|.|..  .::|....:|||....:.|..|. |:.::.|.|                 :|.||.
  Fly   401 TKCGCVK--FSMPRNVDMPVCGEDKIHCYDRAERELLVREFKRVKALNAGRENSRSVESACNCMP 463

  Fly   317 SCEEPEYNIIYNSADEDDEASDEVSEIRVA------LVELPTQRYVRR---------VTKT---- 362
            :|.    :::||:  |..:|:.::.|:.||      |.|.|..:..|.         :|..    
  Fly   464 ACT----SLVYNT--EISQANFDLEEMLVAEGDTEFLKEYPGSQMSRLSIYFKQSQFITSKRSEL 522

  Fly   363 --ILDFLISLGGLVGLFFNTSALRIVETIV-ICLRYRKTIVKWVK 404
              :.:||.:.||:.|||...|.|.:||.|. ..||....:.:.||
  Fly   523 YGMTEFLANCGGIFGLFMGFSILSLVEMIYHFTLRLFTNLKRLVK 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 77/361 (21%)
rpkNP_001246909.1 ASC 39..552 CDD:279230 103/483 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.