DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and ppk27

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_647826.2 Gene:ppk27 / 38440 FlyBaseID:FBgn0035458 Length:422 Species:Drosophila melanogaster


Alignment Length:407 Identity:72/407 - (17%)
Similarity:143/407 - (35%) Gaps:85/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FANVSL-SLLNSYLSSSVSFNLDTI-YLNWNSTFPAITVCEIYNAERIWDLSDSN-FGVEHDM-- 76
            ||:.:: |::..:||.|...:|..: .|.....||.:.:|..|.      .|..| ....||:  
  Fly    50 FASYAVFSMVLEFLSYSTIADLSELKVLEDEIHFPELKICSGYK------FSYRNMLASAHDLVS 108

  Fly    77 ----HVDDFISEIVFYRGV-------CSSCEDCSRMRCPSNFTHLVDVFRTKCHQLLVNCTYLNK 130
                .:|.:::::....|.       ..:.:|.:.:....|.:..:......|..|::.|...|.
  Fly   109 SQNKSLDYWLNKLSLLSGYFDALSVKAENVDDLNSLLDIKNISSFLLALTPACESLILKCKLNNI 173

  Fly   131 LFDCCDQFLPLPTEYGLCFSFNSHQARKVSHLQFTNNRMTGPGHLSFHAAADIQLY--------- 186
            ..:|...|.......|.|             ....|:.:||...| |..::.|..|         
  Fly   174 PANCLKLFTLKAYNDGNC-------------CVLRNSNLTGELTL-FMDSSQIDEYPLNGNLPGF 224

  Fly   187 -VHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDESVQDLSMEQRRCRYGHEHVPERQGI 250
             :|.|        ....|.::..|....:.:.|:|:..:..:.:.::|:|.|.:..|.       
  Fly   225 SLHVP--------SWQGRVSINPGEMAAVEIEVMELQGNSQLNEYAVEKRACYFSQEG------- 274

  Fly   251 YDFYSYSGCVVECTVLLQLDNCNCTSHFMAIPGQNYLPVCDVRGLICLTRIRDKIMTERKSCECM 315
               .|...|:.||.:...|.||.|..:......|.: ..|.:..:.|| ::.::..:..:..:|:
  Fly   275 ---ESREKCLHECRIKATLINCQCVPYPFEFRTQKF-GYCTLENIRCL-QLVERNWSPAQCPQCL 334

  Fly   316 SSCEEPEYNIIYNSADEDDEASDEV--------SEIRVALVELPTQRYVRRVTKTILDFLISLGG 372
            ..|.:..|.:           :.::        ||:.........|||...:.......|.::||
  Fly   335 PLCNQLFYRL-----------NKQILGHLHPWRSELNFKFKTPHRQRYKTNILYHWYQMLSNVGG 388

  Fly   373 LVGLFFNTSALRIVETI 389
            ::|:....|.:...|.|
  Fly   389 VLGICIGCSFISGFELI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 47/277 (17%)
ppk27NP_647826.2 ASC 15..407 CDD:279230 72/407 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.