DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and ppk12

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster


Alignment Length:518 Identity:101/518 - (19%)
Similarity:178/518 - (34%) Gaps:190/518 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TFYHTLPFFANVSLS------LLNSYLSSSV--SFNLDTIYLNWNST-----------------F 48
            |..|.|.|..:..||      .|.|::::.:  ...:..||:.|:||                 |
  Fly    33 TSLHGLKFVGDSGLSSWERSFFLGSFVTALIITVHLISNIYVKWDSTPVIIGISPQATSILKVPF 97

  Fly    49 PAITVCEIYNAER-----------------------IWDLSD-------SNFGVEHDMHVDDFIS 83
            ||||:|.:...:|                       .|:.|:       ||| |.:::.:.:|:|
  Fly    98 PAITICNMNQVQRSLVANYREGSNESALLKLLCESDSWESSEADEEFSASNF-VTNNLKISEFVS 161

  Fly    84 EIVFYRGVCSSCEDCSRMRCPSNFTHLVDVFRTKCHQLLVNCTYLNKLFDCCDQFLPLPTEYGLC 148
                     :..:.|.||                    |:.|.:.....:|...|..:.|:.|||
  Fly   162 ---------NHSQSCERM--------------------LLFCRFSAVERNCSQLFQQILTDEGLC 197

  Fly   149 FSFNSHQARKVSHLQFTNNR--------------------------------MTGPG-HLSFHAA 180
            ..|| .|..:..:..|.||.                                .:|.| .|.|.|.
  Fly   198 CVFN-FQPPEYLYKPFANNNRNLTNSDGFESVMWDPESGYPEQLPPKFYPATASGTGITLGFTAV 261

  Fly   181 ADIQL---------------YVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDESVQDL 230
            .|.::               |.|.||:||.....|:|.   .:|:.....:.::......:::.:
  Fly   262 LDAEMGEYYCSSTNGPGFKVYFHNPIEVPKVKEAGLIS---AIGYETNYRIEMVRAEAVPAIRSI 323

  Fly   231 SMEQRRCRYGHEHVPERQGIYDFYSYSGCVVECTVLLQLDNCNCTSHFMAIPGQNYL-----PVC 290
            |.:.|:|.:.:|   :....|..|:...|..||......|.|:|      ||..:.|     .:|
  Fly   324 SRDGRQCLFKNE---KELIFYRIYTRLNCENECLAAFLYDTCSC------IPFDHPLIYSNASIC 379

  Fly   291 DVRGLICLTRIRDKIMTERKS-------C--ECMSSCEEPEYNIIYNSADEDDEASDEVSEIRVA 346
            .:....|:.|      .:|.|       |  :|:.||    :::.|.::......:....::..|
  Fly   380 SMGDTSCVRR------AQRASNRPGWAKCRQQCLPSC----FDLNYLASGFSFPLASNNFQLANA 434

  Fly   347 LVELPTQRYVRR----------------VTKT----ILDFLISLGGLVGLFFNTSALRIVETI 389
            |||...:.|:.:                .||.    :.:||.::||::|||...|.:.:.|.:
  Fly   435 LVESFNKSYLSKNIAVINVYFRESVYYGNTKNAYVGLTEFLSNVGGVMGLFMGFSVISLAEIL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 67/341 (20%)
ppk12NP_611672.1 deg-1 28..499 CDD:273309 101/518 (19%)
ASC 29..499 CDD:279230 101/518 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.