DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and ppk7

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster


Alignment Length:477 Identity:111/477 - (23%)
Similarity:178/477 - (37%) Gaps:130/477 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LYLVTFYHTLPFFANVSLSLLNSYLSSSVSFNL---DTIYLNWNSTFPAITVCEIYNAERI-WDL 65
            ::|.||...  |...|.:.|:.|...::..|..   .|.:..:...||.||:|   |..|: |..
  Fly    62 VWLCTFVSA--FLGAVYVCLILSARYNAAHFQTVVDSTRFPVYRIPFPVITIC---NRNRLNWQR 121

  Fly    66 ---SDSNFGVEHDMHVDDFISEIVF------YRGVCSSCEDCSRMR-CPS------NFTHLVDVF 114
               :.|.|...........:.|::.      |.|...|.|   |:| .|:      ||:.:||..
  Fly   122 LAEAKSRFLANGSNSAQQELFELIVGTYDDAYFGHFQSFE---RLRNQPTELLNYVNFSQVVDFM 183

  Fly   115 RTKCHQLLVNCTYLNKLFDCCDQFLPLPTEYGLCFSFNSHQARKVSHLQFTNNR---MTG----- 171
            ..:|::||..|.:.:..:|||:.|....::.|||::|||.:..:...:|..:..   .||     
  Fly   184 TWRCNELLAECLWRHHAYDCCEIFSKRRSKNGLCWAFNSLETEEGRRMQLLDPMWPWRTGSAGPM 248

  Fly   172 ---------------PGHLSFHAAADIQLYVHAPI---DVPYQFSEGMIRETVLLGHYKELILNV 218
                           |||...:|...|.:.|..|.   :.|:..:..  .||.:      .|..|
  Fly   249 SALSVRVLIQPAKHWPGHRETNAMKGIDVMVTEPFVWHNNPFFVAAN--TETTM------EIEPV 305

  Fly   219 IEVHNDESVQDLSMEQRRCRYGHEHVPERQGIYDFYSYSG-------CVVECTVLLQLDNCNCTS 276
            |..: |...:.:..:||:|.:..||..:     ||.|..|       |..||.....:..||||.
  Fly   306 IYFY-DNDTRGVRSDQRQCVFDDEHNSK-----DFKSLQGYVYMIENCQSECHQEYLVRYCNCTM 364

  Fly   277 HFMAIPGQNYLPVCDVRGLICLTRIRDKIMTERK--------------SCECMSSCEEPEYNIIY 327
            ..:..|||  ...|..:.|:||....|.::....              ||:|..:|    |::.|
  Fly   365 DLLFPPGQ--YRSCRAQDLLCLAEHNDLLIYSHNPGEKEFVRNQFQGMSCKCFRNC----YSLNY 423

  Fly   328 NSADEDDEASDEVSEIRVALVELPTQRYVRR---------------VTKTIL-----DFLISLGG 372
                        :|::|.|.  ||...|...               |.:|.|     |.::|.||
  Fly   424 ------------ISDVRPAF--LPPDVYANNSYVDLDVHFRFETIMVYRTSLVFGWVDLMVSFGG 474

  Fly   373 LVGLFFNTSALRIVE-TIVICL 393
            :.|||...|.:..:| ...:|:
  Fly   475 IAGLFLGCSLISGMELAYFLCI 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 74/326 (23%)
ppk7NP_609016.2 ASC 38..493 CDD:279230 110/472 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.