DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and ppk23

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster


Alignment Length:474 Identity:109/474 - (22%)
Similarity:174/474 - (36%) Gaps:156/474 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VSLSLLNSYLSSSVSFNLDTIYLNWNSTFPAITVC------------EIYNAERIWD-------- 64
            :.:||...:.::.....|||.:.|.|..||...||            ::||....:|        
  Fly    73 IIMSLWEKFQTNPTITGLDTDFHNQNVVFPTTVVCPEAAFDHDKTYEKVYNTLANYDEAQAQMYT 137

  Fly    65 -----LSDSNFGVEHDMHVDDFISEIVFYRGVCSSCEDCSRMRCPSNFTHLVDVFRTK------- 117
                 |:..||....|..|   :|:.:                 |.|   |:|....:       
  Fly   138 PFLRILTSLNFENVRDAKV---LSQSI-----------------PQN---LLDAHTIREWAFEGH 179

  Fly   118 --CHQLLVNCTYLNKLFDCCDQFLPLPTEYGLCFSFNSHQARKVSHLQF----TNNRMTGPGH-- 174
              |..:.|:|.|.::...|||.|.|:.||:|.|::|||         :|    |.:..||..|  
  Fly   180 IDCKNVFVSCKYRDEDIPCCDHFEPIYTEHGFCYAFNS---------RFKSTPTEDVKTGAPHDL 235

  Fly   175 --------LSFHAAADIQLYV-----------HAPIDVPYQFSEGMIRETVLLGHYKELILNVIE 220
                    |.|...:..::::           :|.||    :||..:         .|:.::...
  Fly   236 YETDKKWALFFIPNSTSRIFIFSNEEYFGSDFNAQID----WSEPQL---------VEVRISKKN 287

  Fly   221 VHNDESVQDLSMEQRRCRYGHE----HVPERQGIYDFYSYSGCVVECTVLLQLDNCNCTSHF--- 278
            .:..:..:.||:.||:|.:..|    :.|      |.|::|.|:.:|.:...:..|.|...|   
  Fly   288 TYTTDDARQLSIGQRKCIFSDEVKLNYFP------DAYTFSSCMKQCRMNKAIKLCKCNPPFYKP 346

  Fly   279 ---------------------MAIPGQNYLPVCDVRGLICLTRIRDKIMTERKSC-ECMSSCEEP 321
                                 ...|..| :|:|.::...||...:..| |..|.| :|..||.:.
  Fly   347 IRELSCVINIFTNLIAYILLLYLTPKAN-VPMCSIKDFDCLDEFKSNI-TNIKDCLQCELSCSKT 409

  Fly   322 EYNIIYNSADEDDEASDEVSEIRVALVEL---PTQRYVRRVTKTILDFLISLGGLVGLFFNTSAL 383
            .:||     |:..:.||....:.| |||.   |..||.|.|....:|.|:|.||:..||...|.|
  Fly   410 VFNI-----DKLIKMSDRPESLGV-LVEFLTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLL 468

  Fly   384 RIVETI------VICLRYR 396
            ..||.|      ..|:.|:
  Fly   469 SGVEIIYYFTLRACCMVYK 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 77/316 (24%)
ppk23NP_001097011.1 ASC 34..476 CDD:279230 107/461 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.