DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and ppk22

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_733051.2 Gene:ppk22 / 318593 FlyBaseID:FBgn0051105 Length:561 Species:Drosophila melanogaster


Alignment Length:491 Identity:108/491 - (21%)
Similarity:180/491 - (36%) Gaps:124/491 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MILYLVTFYHTLPFFANVSLSLLNSYLSSSVSFNL-DTIYLNWNSTFPAITVCE---------IY 57
            :|..||....|:.....:||: ...:::.|...|| |.::...|..|||:::|.         |.
  Fly    67 LIWLLVHMATTVSLIVVLSLT-WEQFVAQSFVTNLKDPLFPVENVPFPAVSICPNNRISRQAVIQ 130

  Fly    58 NAERIWDLSDSNFGVEHDMHVDDFISEIVFYRGVCSSCEDCSRMRCPSNFTHLVDVFRT------ 116
            .||.:...|.....||:.:....|..|...:.||....:|.      ..|...:|||.|      
  Fly   131 YAEELRLNSPVIRPVEYFLERLRFFREFYTHVGVVVDTDDF------ITFQTFLDVFGTWNNETF 189

  Fly   117 ------------KCHQLLVNCTYLNKLFDCC--DQFLPLPTEYGLCFSFNSHQARKVSHLQFTNN 167
                        :|...::.||..|....|.  |.|....|.||.|.:||.....|..|.:   |
  Fly   190 FDTRRIMKMLTPRCQGFVLKCTVANVEVPCFSKDAFQDSLTMYGPCCTFNMENKLKKRHFK---N 251

  Fly   168 RMTGPGHLSFHAAADIQLYV-----HAPIDVPYQFSEGMIRETVLLGHYKE-----LILNVIE-- 220
            |:         |::::.|.|     |.....|...:.|.|    ::.|..|     ...||:|  
  Fly   252 RL---------ASSELGLKVVLNDSHVDYFAPILNTNGYI----VMIHNAENYASVYSSNVLEMF 303

  Fly   221 ---------------VHNDESVQDLSMEQRRCRYGHE-HVPERQGIYDFYSYS----GCVVECTV 265
                           |..|:|::..|...|||.:.:| ..|..:.:.:.||.|    .|:..|.:
  Fly   304 PGQGEDSYIAVCARVVDTDDSLKSFSPFSRRCYFEYEAQNPIHEQLMNTYSLSYTFPNCITRCRI 368

  Fly   266 LLQLDNCNCTSHFMA------IPGQNYLPVCDVRGLICLTRIRDK---IMTERK----------- 310
            ...:..|.|....|.      :.|..|   |.:..:.||.:...|   |:|||.           
  Fly   369 RSIIALCRCLPFQMPLQLVENLDGVVY---CTLGHVSCLNQYIFKWRNILTERHIVNGLEREIEE 430

  Fly   311 --SC-ECMSSCEEPEYNIIYNS-----------ADEDDEA--SDEVSEIRVALVELPTQRYVRRV 359
              .| :|:.||.:.:|.:..::           .||::|.  ..::|.:||...:...|.|:|.:
  Fly   431 ALYCPQCLPSCRDVQYEVSMSALPIDNYLATLKLDENNETEFGTDISVLRVYFGDPHAQYYIRLL 495

  Fly   360 TKTILDFLISLGGLVGLFFNTSALRIVETIVICLRY 395
            ..|..:...::|.::.:|...|.:.|.|.:....:|
  Fly   496 NNTWFEVFSTIGNIMSIFVGFSMVAIFEILFFVTKY 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 72/329 (22%)
ppk22NP_733051.2 ASC 46..527 CDD:279230 107/485 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.