DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and Asic2

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_037024.2 Gene:Asic2 / 25364 RGDID:2017 Length:563 Species:Rattus norvegicus


Alignment Length:468 Identity:108/468 - (23%)
Similarity:167/468 - (35%) Gaps:164/468 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SLSLLNSYLSSS----VSFNLDT-IYLNWNS--TFPAITVCEIYNAERIWDLSDSN-FGVEH--- 74
            ||.||.|:.|:.    :||...| ::..|:.  .|||:|||. .|..|...||..: :...|   
  Rat    96 SLGLLLSWSSNRLLYWLSFPSHTRVHREWSRQLPFPAVTVCN-NNPLRFPRLSKGDLYYAGHWLG 159

  Fly    75 ----DMHVDDFISEIV--------FYRGVCSSCEDCSRMRCPSNFTHLVDVFRTKC-HQL---LV 123
                :......:||::        ::|.:.    |......|.:|..:...|..:. |||   |:
  Rat   160 LLLPNRTARPLVSELLRGDEPRRQWFRKLA----DFRLFLPPRHFEGISAAFMDRLGHQLEDMLL 220

  Fly   124 NCTYLNKLFDCC--DQFLPLPTEYGLCFSFNSHQARKVSHLQFTNNRMTGPGHLSFHAAADIQLY 186
            :|.|..:|   |  ..|..:.|:||.|:.|||.:..|  .|..|....||.|   .....|||..
  Rat   221 SCKYRGEL---CGPHNFSSVFTKYGKCYMFNSGEDGK--PLLTTVKGGTGNG---LEIMLDIQQD 277

  Fly   187 VHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDES---VQDL-------------SMEQR 235
            .:.||       .|...||......|      :::|:...   :|:|             :.|||
  Rat   278 EYLPI-------WGETEETTFEAGVK------VQIHSQSEPPFIQELGFGVAPGFQTFVATQEQR 329

  Fly   236 ---------RCRYGHEHVPERQGIYDF---YSYSGCVVECTVLLQLDNCNCTSHFMAIPGQNYLP 288
                     .||      ....|: ||   ||.:.|.::|.....::||||  ..:.:||.  .|
  Rat   330 LTYLPPPWGECR------SSEMGL-DFFPVYSITACRIDCETRYIVENCNC--RMVHMPGD--AP 383

  Fly   289 VCDVRGLICLTRIRDK--------IMTERKS--CECMSSCEEPEYNIIYNSADEDDEASDEVSEI 343
            .|        |..:.|        ::.|:.|  |.|.:.|....||             .|:|  
  Rat   384 FC--------TPEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRYN-------------KELS-- 425

  Fly   344 RVALVELPTQRYVRRVTK-------------TILD---------------------FLISLGGLV 374
               :|::|::...:.:.|             .:||                     .|..:||.:
  Rat   426 ---MVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQKKAYEVAALLGDIGGQM 487

  Fly   375 GLFFNTSALRIVE 387
            |||...|.|.|:|
  Rat   488 GLFIGASLLTILE 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 74/333 (22%)
Asic2NP_037024.2 ENaC 64..557 CDD:273304 108/468 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.