DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and Scnn1g

DIOPT Version :10

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_058742.2 Gene:Scnn1g / 24768 RGDID:3641 Length:650 Species:Rattus norvegicus


Alignment Length:537 Identity:104/537 - (19%)
Similarity:180/537 - (33%) Gaps:188/537 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLNSYLSSSVSFNLDTIYLNWNSTFPAITVCEI----YNA--ERIWDLSD-------SNFGVEHD 75
            |:.|:.:.|||..:....|:    |||:|:|.|    |:|  :.:.||..       |.:||:..
  Rat    74 LVFSFYTVSVSIKVHFQKLD----FPAVTICNINPYKYSAVSDLLTDLDSETKQALLSLYGVKES 134

  Fly    76 -----------------------------------------------------------MHVDDF 81
                                                                       |||.:.
  Rat   135 RKRREAGSMPSTLEGTPPRFFKLIPLLVFNENEKGKARDFFTGRKRKISGKIIHKASNVMHVHES 199

  Fly    82 ISEIVFYRGVCSS-CEDCSRMRCPSNFTHLVDVFRTKCH---------------------QLLVN 124
            ...:.|.  :||: ..||:.....|....:.:.:  |.|                     :|||.
  Rat   200 KKLVGFQ--LCSNDTSDCATYTFSSGINAIQEWY--KLHYMNIMAQVPLEKKINMSYSAKELLVT 260

  Fly   125 CTYLNKLFD--CCD--QFL----PLPTEYGLCFSFNSHQARKV------------SHLQFTNNRM 169
            |     .||  .||  .|.    |:   ||.|::||:.:...:            ..:.:.|...
  Rat   261 C-----FFDGMSCDARNFTLFHHPM---YGNCYTFNNKENATILSTSMGGSEYGLQVILYINEDE 317

  Fly   170 TGPGHLSFHAAADIQLYVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDESVQDLSMEQ 234
            ..|..:|...|   ::.:|...:.|:....||..||.:        ...|.:|..||.: ||...
  Rat   318 YNPFLVSSTGA---KVLIHQQNEYPFIEDVGMEIETAM--------STSIGMHLTESFK-LSEPY 370

  Fly   235 RRCRYGHEHVPERQGIYD-FYSYSGCVVECTVLLQLDNCNCTSHFMAI-PGQNYLPVCDVR---- 293
            .:|......||. ..||: .||...|:..|.....::.|.|..:...: |..||   |:.:    
  Rat   371 SQCTEDGSDVPV-TNIYNAAYSLQICLYSCFQTKMVEKCGCAQYSQPLPPAANY---CNYQQHPN 431

  Fly   294 GLICLTRIRDKIMTERKSCE--CMSSCEEPEYNIIYNSADEDDEASD------------------ 338
            .:.|..::....:.|...|:  |..||...|:.:..:.|....|||:                  
  Rat   432 WMYCYYQLYQAFVREELGCQSVCKQSCSFKEWTLTTSLAQWPSEASEKWLLNVLTWDQSQQINKK 496

  Fly   339 ----EVSEIRVALVELPTQRYVRRVTKTILDFLIS-LGGLVGLFFNTSALRIVETI--------- 389
                :::::.:...:| .||.:.......::.|:| .||.:||:.:.|.:.::|.|         
  Rat   497 LNKTDLAKLLIFYKDL-NQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEIIEVFFIDFFS 560

  Fly   390 VICLR-YRKTIVKWVKR 405
            :|..| :.|....|.:|
  Rat   561 IIARRQWHKAKDWWARR 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC 36..387 CDD:459966 92/495 (19%)
Scnn1gNP_058742.2 ENaC 24..631 CDD:273304 104/537 (19%)
Gating release of inhibition by proteolysis (GRIP), protease-sensitive region that is responsible for the proteolytic activation of the channel. /evidence=ECO:0000250|UniProtKB:P51170 135..222 8/88 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..628 1/1 (100%)
PY motif, mediates interaction, ubiquitination and inhibition by NEDD4 and NEDD4L. /evidence=ECO:0000269|PubMed:12654927 624..628
PY motif, recruits WW domain-containing proteins and is thereby required for ubiquitination and inhibition of the channel by NEDD4 and NEDD4L. /evidence=ECO:0000250|UniProtKB:P51170 624..628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.