DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and egas-3

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:312 Identity:65/312 - (20%)
Similarity:106/312 - (33%) Gaps:99/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GLCFSFNSHQARKVSHLQFTNNRMTGPG---------------HLSFHAAADIQLYVHAPIDVPY 195
            |.||:|| |:.|..::|      |..||               :..::..|.|.:::|...|  |
 Worm   649 GNCFTFN-HRDRNFTYL------MRRPGRHGGIQAFMKTRQDEYAPWYDTAAINVFIHNRDD--Y 704

  Fly   196 QFSEG----------------MIRETVLLGHYKELILNVIEVHNDESVQDLSMEQRRCRYGHEHV 244
            .|||.                |.|.|.|.|:|.:.|....||.|                     
 Worm   705 VFSESVRYNAQPNAQSTINIFMTRYTRLGGNYGKCIKKPSEVKN--------------------- 748

  Fly   245 PERQGIYDF---YSYSGCVVECTVLLQLDNCNCTS-HFMAIPGQNYLPVCDVRGLICLTRIRDKI 305
                  |.:   |:..||:..|......:.|||.. .:...|...   .|.:....|:|...:..
 Worm   749 ------YYYPGAYTTDGCLRTCYQDRMKEECNCMDPRYPQAPNST---SCQLSERSCVTEASEAA 804

  Fly   306 --MTERKSCECMSSCEEPEYNIIYNSADEDD-----EASDEVSE----------IRVALVELPTQ 353
              .:...||.|...|...||::.::.|:..:     |.|.:|:.          :.:.|.:|..:
 Worm   805 GDPSTWSSCVCPLPCSNQEYSVTWSKANFVNLPITCEKSSDVATCQKQYKDQLMVSIILPQLDFK 869

  Fly   354 RYVRRVTKTILDFLISLGGLVGLFFNTSALRIVETI--------VICLRYRK 397
            .|..........||..|||.:|:....:.:..:|.:        |:|.:|.|
 Worm   870 IYAETPAMDFNKFLSQLGGQLGVLMGINVVTFIEVVFLFFGMFMVLCQKYEK 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 60/292 (21%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 61/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.