DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and mec-10

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_509438.1 Gene:mec-10 / 181101 WormBaseID:WBGene00003174 Length:724 Species:Caenorhabditis elegans


Alignment Length:323 Identity:76/323 - (23%)
Similarity:116/323 - (35%) Gaps:74/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 HQLLVNCTYLNKLFDCCDQFLPL---PTEYGLCFSFNSHQARKVSHLQFTNNRMTGP-------- 172
            |.|:..|::..|..| .||...|   || :|.||.|| |. |::    |.::...||        
 Worm   404 HNLIHKCSFNGKPCD-IDQDFELVADPT-FGNCFVFN-HD-REI----FKSSVRAGPQYGLRVML 460

  Fly   173 -----GHLSFHAAADIQLYVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDESVQDLSM 232
                 .:|....|..|:|.:|...|.|:..:.|....|..:..:              .::...|
 Worm   461 FVNASDYLPTSEAVGIRLTIHDKDDFPFPDTFGYSAPTGYISSF--------------GMRMKKM 511

  Fly   233 EQRRCRYGH--EHVPERQGIYDFYSYS--GCVVECTVLLQLDNCNCTS-HFMAIPGQNYLPVCDV 292
            .:....||.  |.......||..|:||  ||...|...|.:|.|.|:. .|.:|.|.....|.:.
 Worm   512 SRLPAPYGDCVEDGATSNYIYKGYAYSTEGCYRTCFQELIIDRCGCSDPRFPSIGGVQPCQVFNK 576

  Fly   293 RGLICLTRIRDKIMTERKS--CECMSSCEEPEYNIIYNSA---------------DEDDEASDEV 340
            ....||.:...:|.....|  |.|...|.:..|...|:.|               .|.:|.::|.
 Worm   577 NHRECLEKHTHQIGEIHGSFKCRCQQPCNQTIYTTSYSEAIWPSQALNISLGQCEKEAEECNEEY 641

  Fly   341 SEIRVAL--------VELPTQRYVRRVTKTILDFLISLGGLVGLFFNTSALRIVETIVICLRY 395
            .|....|        .|:.::.....:.|.:.||    ||.:||:...|.:...|  .:||.:
 Worm   642 KENAAMLEVFYEALNFEVLSESEAYGIVKMMADF----GGHLGLWSGVSVMTCCE--FVCLAF 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 70/305 (23%)
mec-10NP_509438.1 ASC 88..723 CDD:295594 76/323 (24%)
deg-1 99..696 CDD:273309 74/319 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.