DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and egas-1

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001359624.1 Gene:egas-1 / 180219 WormBaseID:WBGene00013486 Length:922 Species:Caenorhabditis elegans


Alignment Length:306 Identity:61/306 - (19%)
Similarity:104/306 - (33%) Gaps:86/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GLCFSFNSHQARKVSHLQFTNNRMTG---------PGHLSFHAAADIQLYVHAPIDVPYQFSEG- 200
            |.||:|| |:.|..::...::.|..|         ..:..::..|.|.:::|...|  |.|||. 
 Worm   649 GNCFTFN-HRDRNFTYRLRSSGRHGGIQAFMKTRQDEYAPWYDTAAINVFIHNRDD--YVFSESV 710

  Fly   201 ---------------MIRETVLLGHYKELILNVIEVHNDESVQDLSMEQRRCRYGHEHVPERQGI 250
                           |.|.|.|.|.|.:.:....||.|                           
 Worm   711 RYNAQPNAQSTMNIFMTRYTRLGGRYGKCVKKPSEVKN--------------------------- 748

  Fly   251 YDF---YSYSGCVVECTVLLQLDNCNCTS-HFMAIPGQNYLPVCDVRGLICLTRIRDKIMTERK- 310
            |.:   |:..||:..|........|||.. .:...||.  :..|.:....|:|...:......| 
 Worm   749 YYYPGAYTTDGCLRTCYQDRMKQECNCMDPRYPQAPGN--VTSCQLSERSCVTVASEAAGDPSKW 811

  Fly   311 -SCECMSSCEEPEYNIIYN-------------SADEDDEASDEVSEIRVALV--ELPTQRYVRRV 359
             .|.|...|...||::.::             |:|.....:..:.::.|::|  :|..:.|....
 Worm   812 WDCVCPLPCSNQEYSVTWSKANFVNLPIICGKSSDVSTCKAHYIDQLMVSIVLPQLDFKIYAENP 876

  Fly   360 TKTILDFLISLGGLVGLFFNTSALRIVETIVI--------CLRYRK 397
            ......||..|||.:|:....:.:..:|.:.:        |.:|.|
 Worm   877 AMDFNKFLSQLGGQLGVLMGINLVTFIEVVFLLFGLFTLCCKKYGK 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 57/286 (20%)
egas-1NP_001359624.1 deg-1 <595..908 CDD:273309 58/290 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.