DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and del-6

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_741622.2 Gene:del-6 / 179474 WormBaseID:WBGene00011891 Length:577 Species:Caenorhabditis elegans


Alignment Length:228 Identity:48/228 - (21%)
Similarity:84/228 - (36%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 QFSEGMIR------ETVLLGHYKELILNVIEVH----NDESVQDLSMEQRRCRYGHEHVPERQGI 250
            :|.||..|      :.|.||...|:..:|..::    |||       :..|||    .|.:.:. 
 Worm   294 RFMEGKGRSRDGYVDEVCLGQRHEVTAHVTALYQMLENDE-------QGTRCR----DVEDGED- 346

  Fly   251 YDFYSYSGCVVECTVLLQLDNCNCT----SHFMAIPGQNYLPVCDVRGLICLTRIRDKIMTERKS 311
                |...|...|.:.:..|.|:||    |:..........|:||...  |...::....::.:.
 Worm   347 ----SEFNCRSRCRMEMIRDACHCTPLSLSYLAKKEDMEIFPLCDYTQ--CTVDVQKGNYSDTEC 405

  Fly   312 C-ECMSSCEEPEYNIIYNSADEDDEASDEVSEIRVALVELP-------TQRYVRRVTKTILDFLI 368
            . :|...|.:..:.:       |......:....:.||||.       |.....:.:.|  .|:.
 Worm   406 ANKCFPDCRQIRFEV-------DHSVKGRMLRPDLTLVELSWGPFEYLTMEQQWKYSAT--SFIA 461

  Fly   369 SLGGLVGLFFNTSALRIVETIVICLRY-RKTIV 400
            :|||.:|::...|.|.:::.:.....| .|.||
 Worm   462 ALGGSIGMWLGLSILSLIQLVTYSYTYFTKKIV 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 44/212 (21%)
del-6NP_741622.2 ASC <347..484 CDD:295594 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.