DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and LOC1270354

DIOPT Version :10

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_309041.5 Gene:LOC1270354 / 1270354 VectorBaseID:AGAMI1_014079 Length:119 Species:Anopheles gambiae


Alignment Length:41 Identity:11/41 - (26%)
Similarity:20/41 - (48%) Gaps:11/41 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FFANVSLSLLNSYLSSSVSFNLDTIYLNWNSTFPAITVCEI 56
            |.:|.:|:.:     .:.|:.:..|      .|||:|:|.|
Mosquito    75 FRSNPTLTTI-----ETTSYPVSLI------AFPAVTLCNI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC 36..387 CDD:459966 7/21 (33%)
LOC1270354XP_309041.5 None

Return to query results.
Submit another query.