DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and asic2

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_004918663.1 Gene:asic2 / 100492214 XenbaseID:XB-GENE-6033380 Length:541 Species:Xenopus tropicalis


Alignment Length:473 Identity:106/473 - (22%)
Similarity:163/473 - (34%) Gaps:154/473 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLVTFYHTLPFFANVSLSLLNSYLSSSVSFNLDT-IYLNWNS--TFPAITVCEIYNAERIWDLSD 67
            :.:.|:.:|.||.:.|.:.|..:|    ||...| :.|.|:.  .|||:|.|. .|..|...||.
 Frog    69 WFLAFFTSLGFFLSWSSNRLLYWL----SFPSHTRVQLEWSKELAFPAVTFCN-NNPVRFHRLSK 128

  Fly    68 SNFGVEHDMHVDDFISEIVF----------------YRGVCSSCEDCSRMRCPSNFTHLVDVFRT 116
            |      |::...:...::|                .|.......|......|.||..:...|..
 Frog   129 S------DLYFAGYWLGLLFANRTARPMLAELLPEDRRKWFQKLADFRLFLPPRNFDGISVGFMD 187

  Fly   117 KC-HQL---LVNCTYLNKLFDCC--DQFLPLPTEYGLCFSFNSHQ-ARKVSHLQFTNNRMTGPGH 174
            :. |||   |::|.|..   :.|  ..|..:.|.||.|:.|||.| .|.|.      ..:.|...
 Frog   188 RLGHQLEDMLLSCKYRG---EACGPHNFSTVFTRYGKCYMFNSGQDGRPVL------TTVKGGAG 243

  Fly   175 LSFHAAADIQLYVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDES---VQDL------ 230
            .......|||...:.||       .|...||......|      :::|:...   :|:|      
 Frog   244 NGLEIMLDIQQDEYLPI-------WGDTEETTFEAGVK------VQIHSQSEPPFIQELGFGVAP 295

  Fly   231 -------SMEQR---------RCRY---GHEHVPERQGIYDFYSYSGCVVECTVLLQLDNCNCTS 276
                   :.|||         .||:   |.:..|       .||.|.|.::|.....::||.|  
 Frog   296 GFQTFVATQEQRLTYLPSPWGACRFSELGSDFFP-------VYSISACRIDCETRYIVENCGC-- 351

  Fly   277 HFMAIPGQNYLPVCDVRGL-ICLTRIRDKIMTERK--SCECMSSCEEPEYNIIYNSADEDDEASD 338
            ..:.:||.  .|.|..... .|.....| ::.|:.  :|.|...|....||             .
 Frog   352 KMVHMPGD--APFCTPEQYKECAEPALD-LLAEKDGGNCVCTIPCNVTRYN-------------K 400

  Fly   339 EVSEIRVALVELPTQ---RYV----RRVTKTILDFLI---------------------------S 369
            |:|     :|::|::   :|:    .:..|.|||.::                           .
 Frog   401 ELS-----MVKIPSKTSAKYLEKKFNKSEKYILDNILVLDVFFEALNYETIEQRKAYEVAGLLGD 460

  Fly   370 LGGLVGLFFNTSALRIVE 387
            :||.:|||...|.|.|:|
 Frog   461 IGGQMGLFIGASILTILE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 70/327 (21%)
asic2XP_004918663.1 ASC 49..497 CDD:383197 106/473 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.