DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and asic4

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_031749131.1 Gene:asic4 / 100486325 XenbaseID:XB-GENE-940165 Length:535 Species:Xenopus tropicalis


Alignment Length:445 Identity:94/445 - (21%)
Similarity:150/445 - (33%) Gaps:170/445 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FPAITVC-------------EIYNAERIWDL--SDSNFGVEHDMHVDDFISEIVFYRGVCSSCED 97
            |||||:|             :||:...:..|  .|.....:.|:..||                 
 Frog   110 FPAITICNINRFRHSALTDPDIYHLANLTGLPPKDREGHRDSDLMYDD----------------- 157

  Fly    98 CSRMRCPSNFTHLVDVFRTKCHQL---LVNCTYLNKLFDCC--DQFLPLPTEYGLCFSFNSHQAR 157
                      ..::|:.....|||   |.:|.:..   |.|  ..|..:.|.||.|::||:.:..
 Frog   158 ----------PDMLDIVNRTGHQLAEMLKSCNFSG---DSCSAQNFSVVFTRYGKCYTFNADKKH 209

  Fly   158 -KVSHLQFTNNRMTGPGHLSFHAAADIQLYVHAPI--DVPYQFSEGMIRETVLLGHYKELILNVI 219
             |||       |..|.|: ......|||...:.||  :......|..||               :
 Frog   210 PKVS-------RQGGMGN-GLEIMLDIQQEEYLPIWRETNETSFEAGIR---------------V 251

  Fly   220 EVHNDESVQD-------------------LSMEQRRCRY-----GH--EHVPERQGI--YDFYSY 256
            ::|:    ||                   :|.:::|..|     |:  ..:|..:.:  |..||.
 Frog   252 QIHS----QDEPPYIHQMGFGVSPGFQTFVSCQEQRMTYLPQPWGNCRSSIPGEEFLSGYSTYSI 312

  Fly   257 SGCVVECTVLLQLDNCNCTSHFMAIPGQNYLPVCDVRGLICLTRIRDKIMTE-RKSCECMSSCEE 320
            |.|.::|.....:..|.|  ..:.:||..  .:|.....:|...|.|.::.: .:.|.|.:.|..
 Frog   313 SACRLQCEKEAVIRKCAC--RMVHMPGNE--TICSPVMYMCADHILDNMVEDTSEKCSCPTPCNL 373

  Fly   321 PEYNIIYNSADEDDEASDEVSEIRVALVELPTQ---RYV-RRVTKT---------ILD------- 365
            ..|             |.|:|.:|:     |.:   ||: |:..|.         :||       
 Frog   374 TRY-------------SKEISMVRI-----PNKGSARYLARKYNKNETYIRENFLVLDIFFEALN 420

  Fly   366 --------------FLISLGGLVGLFFNTSALRIVETIVICLRYRKTIVK-WVKR 405
                          .|..:||.:|||...|.|.|:|    .|.|...::: .|||
 Frog   421 YETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILE----ILDYMYEVIRDKVKR 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 69/327 (21%)
asic4XP_031749131.1 ASC 39..514 CDD:413546 94/445 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.