DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12118 and mmadhca

DIOPT Version :9

Sequence 1:NP_572537.1 Gene:CG12118 / 31857 FlyBaseID:FBgn0030101 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001002453.1 Gene:mmadhca / 436726 ZFINID:ZDB-GENE-040718-152 Length:291 Species:Danio rerio


Alignment Length:267 Identity:59/267 - (22%)
Similarity:94/267 - (35%) Gaps:79/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VARYSKRNGP----PSDAGGYFKTVKSRDLDDDDELNSLESEPNWELTAERGNRFYLPNGIGPAW 106
            :|..|:..||    |.:|.|.|                          ..:..||.||..:|...
Zfish    44 IAVPSQNTGPRTVWPDEAMGPF--------------------------GPQDQRFQLPGNVGFDC 82

  Fly   107 QGDSTTVGLLEP---------------------LGHLVNFHKGPNT--------------DKSRL 136
            ....|.:.:..|                     |...:|..:|...              .:|.:
Zfish    83 HLKGTELQMSGPVHKTVPDVLSVPSSTERHEFILAQFINEFQGKEASVAVQRVSKAELYFSQSDV 147

  Fly   137 EFTCCKCPLLIRVPLLEIFPV----PVVAQQCINITMLVLSHE--GDIEMGAAKFVLAAREMCDR 195
            |.:...||.|::..|...|||    |:..     :|::..:.|  .|.|.....||..|:|:|..
Zfish   148 ECSMRSCPELLKKELELFFPVLPTSPITV-----VTVMQKNQELTRDQEELLDNFVSGAKEICFT 207

  Fly   196 LLSYGYWADFMNPFSGRPFFLPREGANLYRLDSRFRGLNMRLSEQNRCTVISAEKNDSTRFSGTI 260
            |...||||||:||.||:.||..:...::.:.|.:... ...:.:...||||......:  |..|:
Zfish   208 LWRGGYWADFINPLSGKAFFAVQTPDSILQQDVQHHA-GFHIEDLASCTVIRHVLKGT--FVLTL 269

  Fly   261 YSTAPNH 267
            .:.||::
Zfish   270 ITNAPSN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12118NP_572537.1 DUF2246 22..275 CDD:287231 59/267 (22%)
mmadhcaNP_001002453.1 MMADHC 24..284 CDD:313456 59/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9613
eggNOG 1 0.900 - - E1_KOG3994
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5325
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363001at2759
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 1 1.000 - - otm24685
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - O PTHR13192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5533
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.