DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12118 and mmadhcb

DIOPT Version :9

Sequence 1:NP_572537.1 Gene:CG12118 / 31857 FlyBaseID:FBgn0030101 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_991157.2 Gene:mmadhcb / 402886 ZFINID:ZDB-GENE-040704-50 Length:297 Species:Danio rerio


Alignment Length:201 Identity:57/201 - (28%)
Similarity:89/201 - (44%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LTAERGNR---FYLPNGIGPAWQGDSTTVGLLEPLGHLVNFHKGPN-TDKSRLEFTCCKCPLLIR 148
            |||:..|:   |.|...|....:.|.|:..        .|..|... .|.|.:|.....||.|::
Zfish   101 LTAQSNNQRHDFILAQFINELHEDDKTSTA--------QNMDKAEQFFDHSSVECAIQSCPELLK 157

  Fly   149 VPLLEIFP-VPVVAQQCINIT------MLVLSHEGDIEMG--AAKFVLAAREMCDRLLSYGYWAD 204
            .....:|| .|......:.:|      |...:.:.|.|..  .|||:..|:|:|..|.:.|:|||
Zfish   158 RDFESMFPEAPSTGMMVVTVTQRTQNDMTAWTEQVDQEREELLAKFIEGAKEICHALRNEGFWAD 222

  Fly   205 FMNPFSGRPFFLPREGANLYRLDSRFRGLNMRLSEQNRCTVISAEKNDSTRFSGTIYSTAPNHYG 269
            |::|.||..:|.......|:..|.|:|.|..::.:...|.||......:..|.||::::||.: .
Zfish   223 FIDPSSGLAYFGSYTNNTLFETDDRYRHLGFQIEDLGCCKVIRHVMWGTHAFVGTLFTSAPPN-S 286

  Fly   270 QLMKLL 275
            |:||.|
Zfish   287 QIMKKL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12118NP_572537.1 DUF2246 22..275 CDD:287231 56/199 (28%)
mmadhcbNP_991157.2 DUF2246 24..293 CDD:287231 57/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9613
eggNOG 1 0.900 - - E1_KOG3994
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5325
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363001at2759
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 1 1.000 - - otm24685
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - O PTHR13192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4433
SonicParanoid 1 1.000 - - X5533
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.