DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12118 and Mmadhc

DIOPT Version :9

Sequence 1:NP_572537.1 Gene:CG12118 / 31857 FlyBaseID:FBgn0030101 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001004280.1 Gene:Mmadhc / 362134 RGDID:1303272 Length:296 Species:Rattus norvegicus


Alignment Length:219 Identity:62/219 - (28%)
Similarity:89/219 - (40%) Gaps:47/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RFYLPNGIG-----------PAWQGDSTTVGLL-EPL---------GHLVNFHKGPNT------- 131
            ||.||..||           ...|...|...:| |||         ...||..:..|.       
  Rat    71 RFQLPGNIGFDCHLNGTASQKKSQAHKTLPDVLAEPLSTERHEFVMAQYVNEFQDSNAPVEQEIS 135

  Fly   132 ------DKSRLEFTCCKCPLLIRVPLLEIFP--------VPVVAQQCINITMLVLSHEGDIEMGA 182
                  :.:|:|.....||.|:|.....:||        :..|.|:..: .|.|.|.|.::|..|
  Rat   136 SAETYFESARVECAIQTCPELLRRDFESLFPEVANSKLMILTVTQKTEH-DMTVWSEEVEVEREA 199

  Fly   183 --AKFVLAAREMCDRLLSYGYWADFMNPFSGRPFFLPREGANLYRLDSRFRGLNMRLSEQNRCTV 245
              .||:..|:|:|..|.:.||||||::|.||..||.|.....|:..|.|:|.|...:.:...|.|
  Rat   200 LLEKFINGAKEICYALRAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKV 264

  Fly   246 ISAEKNDSTRFSGTIY--STAPNH 267
            |......:....|:|:  :||.:|
  Rat   265 IRHGLWGTHVVVGSIFTNATADSH 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12118NP_572537.1 DUF2246 22..275 CDD:287231 62/219 (28%)
MmadhcNP_001004280.1 MMADHC 24..293 CDD:402023 62/219 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3994
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363001at2759
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 1 1.000 - - oto96601
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - O PTHR13192
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5533
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.