DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12118 and MMADHC

DIOPT Version :9

Sequence 1:NP_572537.1 Gene:CG12118 / 31857 FlyBaseID:FBgn0030101 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_056517.1 Gene:MMADHC / 27249 HGNCID:25221 Length:296 Species:Homo sapiens


Alignment Length:226 Identity:66/226 - (29%)
Similarity:93/226 - (41%) Gaps:48/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RFYLPNGI-------GPAWQGDSTTVG-----LLEPL---------GHLVNFHKGPNT------- 131
            ||.||..|       |.|.|..|....     |.|||         ...||..:|.:.       
Human    71 RFQLPGNIGFDCHLNGTASQKKSLVHKTLPDVLAEPLSSERHEFVMAQYVNEFQGNDAPVEQEIN 135

  Fly   132 ------DKSRLEFTCCKCPLLIRVPLLEIFP--------VPVVAQQCINITMLVLSHEGDIEMGA 182
                  :.:|:|.....||.|:|.....:||        :..|.|:..| .|.|.|.|.:||...
Human   136 SAETYFESARVECAIQTCPELLRKDFESLFPEVANGKLMILTVTQKTKN-DMTVWSEEVEIEREV 199

  Fly   183 --AKFVLAAREMCDRLLSYGYWADFMNPFSGRPFFLPREGANLYRLDSRFRGLNMRLSEQNRCTV 245
              .||:..|:|:|..|.:.||||||::|.||..||.|.....|:..|.|:|.|...:.:...|.|
Human   200 LLEKFINGAKEICYALRAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKV 264

  Fly   246 ISAEKNDSTRFSGTIYSTA-PNHYGQLMKLL 275
            |......:....|:|::.| |:.:  :||.|
Human   265 IRHSLWGTHVVVGSIFTNATPDSH--IMKKL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12118NP_572537.1 DUF2246 22..275 CDD:287231 65/224 (29%)
MMADHCNP_056517.1 MMADHC 24..293 CDD:402023 65/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9880
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363001at2759
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 1 1.000 - - oto89478
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - O PTHR13192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4433
SonicParanoid 1 1.000 - - X5533
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.