Sequence 1: | NP_572537.1 | Gene: | CG12118 / 31857 | FlyBaseID: | FBgn0030101 | Length: | 284 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056517.1 | Gene: | MMADHC / 27249 | HGNCID: | 25221 | Length: | 296 | Species: | Homo sapiens |
Alignment Length: | 226 | Identity: | 66/226 - (29%) |
---|---|---|---|
Similarity: | 93/226 - (41%) | Gaps: | 48/226 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 RFYLPNGI-------GPAWQGDSTTVG-----LLEPL---------GHLVNFHKGPNT------- 131
Fly 132 ------DKSRLEFTCCKCPLLIRVPLLEIFP--------VPVVAQQCINITMLVLSHEGDIEMGA 182
Fly 183 --AKFVLAAREMCDRLLSYGYWADFMNPFSGRPFFLPREGANLYRLDSRFRGLNMRLSEQNRCTV 245
Fly 246 ISAEKNDSTRFSGTIYSTA-PNHYGQLMKLL 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12118 | NP_572537.1 | DUF2246 | 22..275 | CDD:287231 | 65/224 (29%) |
MMADHC | NP_056517.1 | MMADHC | 24..293 | CDD:402023 | 65/224 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 67 | 1.000 | Domainoid score | I9880 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1363001at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0006544 | |
OrthoInspector | 1 | 1.000 | - | - | oto89478 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_105788 | |
Panther | 1 | 1.100 | - | - | O | PTHR13192 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4433 |
SonicParanoid | 1 | 1.000 | - | - | X5533 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.910 |