DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12118 and Mmadhc

DIOPT Version :9

Sequence 1:NP_572537.1 Gene:CG12118 / 31857 FlyBaseID:FBgn0030101 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006497659.1 Gene:Mmadhc / 109129 MGIID:1923786 Length:403 Species:Mus musculus


Alignment Length:284 Identity:74/284 - (26%)
Similarity:105/284 - (36%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RNGP------PSDAGGYFKTVKSRDLDDDDELNSLESEPN------W--ELTAERG---NRFYLP 99
            ||||      |.    .|.|..|   ...||.:...:.|:      |  |.....|   .||.||
Mouse   125 RNGPLKRVINPR----AFSTAGS---SGSDESHVATAPPDICSRTVWPDETMGPFGPQDQRFQLP 182

  Fly   100 NGIG-----------PAWQGDSTTVGLL-EPL---------GHLVNFHKGPNT------------ 131
            ..||           ...|...|...:| |||         ...||..:..:.            
Mouse   183 GNIGFDCHLNGTASQKKSQAHKTLPDVLAEPLSTERHEFVMAQYVNEFQDSDAPVEQEINSAETY 247

  Fly   132 -DKSRLEFTCCKCPLLIRVPLLEIFP--------VPVVAQQCINITMLVLSHEGDIEMGA--AKF 185
             :.:::|.....||.|:|.....:||        :..|.|:..| .|.|.|.|.::|...  .||
Mouse   248 FESAKVECAIQTCPELLRRDFESLFPEVANSKLMILTVTQKTEN-DMTVWSEEVEVEREVLLEKF 311

  Fly   186 VLAAREMCDRLLSYGYWADFMNPFSGRPFFLPREGANLYRLDSRFRGLNMRLSEQNRCTVISAEK 250
            :..|:|:|..|.:.||||||::|.||..||.|.....|:..|.|:|.|...:.:...|.||....
Mouse   312 ISGAKEICYALRAEGYWADFIDPSSGVAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVIRHSL 376

  Fly   251 NDSTRFSGTIYSTAPNHYGQLMKL 274
            ..:....|:|::.|......:.||
Mouse   377 WGTHVVVGSIFTNATADSSIMRKL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12118NP_572537.1 DUF2246 22..275 CDD:287231 74/284 (26%)
MmadhcXP_006497659.1 MMADHC 131..400 CDD:370900 68/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10030
eggNOG 1 0.900 - - E1_KOG3994
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5359
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 1 1.000 - - oto93047
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - O PTHR13192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4433
SonicParanoid 1 1.000 - - X5533
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.