DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31030 and CG5421

DIOPT Version :9

Sequence 1:NP_001036775.1 Gene:CG31030 / 318563 FlyBaseID:FBgn0051030 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001260418.1 Gene:CG5421 / 34661 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster


Alignment Length:449 Identity:84/449 - (18%)
Similarity:156/449 - (34%) Gaps:130/449 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LILVATLLCLI---IGSCSASISGPFIFWG---------HSRVSSQQTQALV------------- 42
            :..:|:||.::   .||...:.|.|.:.||         ...|::.|.:.::             
  Fly     1 MYFIASLLLIVPIAFGSAPVTSSPPVLVWGVDTPKATSIFQPVTTAQFRKIIRNLQKNNMIVIYL 65

  Fly    43 --ESSSRELPLTQLF---TEAKAIVVF--VRNTTNRLEGTRYPKFQNLVKSG--AWTYLPQRSLA 98
              |.:::::.....|   |:.:.:..:  |....|.:|       :...|:|  .| ::|:.|  
  Fly    66 ASELAAKDINCDLCFPYLTKIQPMNYYSQVEEPLNAVE-------RVAEKTGDIIW-HIPKIS-- 120

  Fly    99 AEPFGLNANIEVVSLSG--HGEEDDSEILLAYNE--AVNTYGRGE--VLGILGSREEEAHFLAKR 157
             |...|.|.:|:....|  |....:...|||::.  ||.||...:  |:.:..:..||...|.:|
  Fly   121 -EMGSLEAEMELPCQKGEIHAFSFNDRNLLAHDAAMAVATYQFSDCPVVHVYTAYTEEDKALQRR 184

  Fly   158 --------------EAAPGGEEEEKAKAAEGSEETEASFIYVAEGNKAVLSLNGPLELRVTNDTL 208
                          :..|...:.|.........:::|..:.|......||:....|         
  Fly   185 KSQKTQHMSIKNKIDGQPSNSDTEVELQPHQISQSQADNMTVLRNEMIVLTFRSIL--------- 240

  Fly   209 KLEEHIKQITFDDQR-------------AKGYGRLSITFMHS-----GEKCTLRFKFSLI----- 250
                    :...:||             |:|...|.:..::|     |....|..:...:     
  Fly   241 --------LATKEQRSVLSPFNRTEVMLAQGREPLQVGLLNSHDIFGGIVMVLNTELGPLIVELI 297

  Fly   251 --RGSWTL-RNVEVEYRELKSVLVARGDEYTLPSAPLGFSYRCSAESVNFLNPARNETIQSLLLS 312
              :|:|.| |.:.:........|...|.|::|....:.. |...|..::|.              
  Fly   298 PSQGNWYLTRMIFMNNTHYPRDLYFYGFEFSLCCTDITV-YSSEASRLSFF-------------- 347

  Fly   313 DFQV----QPWLNGRPEYGEVYDC--IGFVSAPILA-GLFVVTLLLGILGLGISAMLSM 364
            ||.:    |...||.....||..|  ...:..|.:| .:|||.::..||.:|::.:||:
  Fly   348 DFHLDILWQDKDNGLDLQYEVKPCWNCSILMTPTMAQTIFVVLIIAAILWMGLAILLSI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31030NP_001036775.1 ATP-synt_S1 243..377 CDD:310428 30/137 (22%)
CG5421NP_001260418.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3868
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12471
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.