DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31030 and atp6ap1la

DIOPT Version :9

Sequence 1:NP_001036775.1 Gene:CG31030 / 318563 FlyBaseID:FBgn0051030 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001373640.1 Gene:atp6ap1la / 100000415 ZFINID:ZDB-GENE-110318-1 Length:323 Species:Danio rerio


Alignment Length:370 Identity:80/370 - (21%)
Similarity:131/370 - (35%) Gaps:98/370 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FIFWGHSRVSS--QQTQALVESSSRELPLTQLFTEAKAIVVFVRNTTNRLEGTRYPKFQNLVKSG 87
            |:|   .::||  :|..|.||.||.:.|...:..:...     ..:::.|.....|..:.|...|
Zfish    15 FVF---LQISSSYEQLSAFVEGSSDDAPSRDISIQDGG-----SGSSSSLSAAEAPLRRALQPYG 71

  Fly    88 AW--TYLPQRSLAAEPFGLNANIEVVSLSGHGEEDDSEILLAYNEAVNTYGRGEVLGILGSRE-- 148
             |  ...|:|.|...|.                      ||.|:....|| .|:...:..:|:  
Zfish    72 -WQLDVPPRRKLLQSPG----------------------LLLYSPLSVTY-NGKTCILFRARKLA 112

  Fly   149 --EEAHFLAKREAAPGGEEEEKAKAAEGSEETEASFIYVAEGNKAVLSLN-GPLE-LRVTNDTLK 209
              ...|.|.        :..||..:.:...:|:.||   ...:||:|:|. |.:| ||..:..| 
Zfish   113 IRYRNHSLV--------DLTEKTFSPDAPLDTKGSF---CSKDKAILNLRFGDVEDLRGLSIRL- 165

  Fly   210 LEEHIKQITFDDQRAKGYGRLSITFMHSGEKCTLRFKFSLIRGSW-TLRNVEVEYRELKSVLVAR 273
                               ::|.||..|..:            :| ||.||.:.|..........
Zfish   166 -------------------QMSNTFYESAGQ------------NWFTLDNVHIHYNWTYEATFNA 199

  Fly   274 GDEYTLPSAPLGFSYRCSAESV-----NFLNPARNETIQS---LLLSDFQVQPWLNGRPEYGEVY 330
            .|.|    ||...||.|...|.     ..|.|:.|....:   :..:|||:|.:.....::....
Zfish   200 TDVY----APSTNSYHCQHVSSLQKYDTLLVPSANTDHAANWHITFTDFQIQAFNVQSSKFAPAS 260

  Fly   331 DCIGFVSAPILAGLFVVTLLLGILGLGISAMLSMHTPNRFESSRS 375
            ||..|.:..||.||....:||.:|...:..::.:...:|:|..::
Zfish   261 DCATFFTPAILMGLITSLILLLVLAYALHMVVHLKHIDRYEEHKT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31030NP_001036775.1 ATP-synt_S1 243..377 CDD:310428 33/142 (23%)
atp6ap1laNP_001373640.1 ATP-synt_S1 161..310 CDD:399083 38/181 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1111170at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12471
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.