DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31029 and KRT19

DIOPT Version :10

Sequence 1:NP_733347.1 Gene:CG31029 / 318562 FlyBaseID:FBgn0051029 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_002267.2 Gene:KRT19 / 3880 HGNCID:6436 Length:400 Species:Homo sapiens


Alignment Length:95 Identity:20/95 - (21%)
Similarity:38/95 - (40%) Gaps:21/95 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 ESLRRTQLISIFTEMRNMFGKKKGANEADVVAEELRKECDA------------ACRNTKSAKARR 528
            :|...|.|..|.::||:.:         :|:||:.||:.:|            ...:|:..:..|
Human   238 DSAPGTDLAKILSDMRSQY---------EVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSR 293

  Fly   529 KARKALQKTLDEIDKAYPKPAKMRIKKERT 558
            .....|::||..::........|:...|.|
Human   294 SEVTDLRRTLQGLEIELQSQLSMKAALEDT 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31029NP_733347.1 DUF4788 33..228 CDD:406440
DUF4776 335..841 CDD:406413 20/95 (21%)
KRT19NP_002267.2 Head 1..79
Filament 79..390 CDD:459643 20/95 (21%)
Coil 1A 80..115
Linker 1 116..133
Coil 1B 134..225
Linker 12 226..248 3/9 (33%)
Necessary for interaction with PNN. /evidence=ECO:0000269|PubMed:10809736 244..390 18/89 (20%)
Coil 2 249..387 16/84 (19%)
Rod-like helical tail 388..400
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.