DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31029 and KRT17

DIOPT Version :10

Sequence 1:NP_733347.1 Gene:CG31029 / 318562 FlyBaseID:FBgn0051029 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_000413.1 Gene:KRT17 / 3872 HGNCID:6427 Length:432 Species:Homo sapiens


Alignment Length:377 Identity:69/377 - (18%)
Similarity:123/377 - (32%) Gaps:116/377 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 EKAALKKLVDELG--LDEIKVPSPPDT--HEKSRRWHCKCKQPSSSTDTSSCDTNEFTAEKPPRK 301
            |||.::.|.|.|.  ||:::.....:|  ..|.|.|:.: :.|..:.|.|....   |.|:...|
Human    84 EKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQR-QAPGPARDYSQYYR---TIEELQNK 144

  Fly   302 RKAISLTASMERAARRRLMGTCPVKEPVLTQEAYKPPNLCQLCRSDISWLPKISACPYCGYKT-F 365
                .|||:::.|             .:|.|     .:..:|...|              ::| |
Human   145 ----ILTATVDNA-------------NILLQ-----IDNARLAADD--------------FRTKF 173

  Fly   366 EDIQPSEQPYDLTATAQQLLRDCLRKETCELDPSKGDDEAMGDKNKDD-----PNVPQQCGCLGG 425
            |    :||...|:..|.   .:.||:...||..::.|.|...:..|::     .|..::...|.|
Human   174 E----TEQALRLSVEAD---INGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRG 231

  Fly   426 KPCTRCRIRKLCDNFFKENECKIEPLPQAYPQAPSKSQPESKKVNQANSDESLRRTQLISIFTEM 490
            :               ...|..:|     ...||.                    ..|..|..||
Human   232 Q---------------VGGEINVE-----MDAAPG--------------------VDLSRILNEM 256

  Fly   491 RNMFGKKKGANEADV------VAEELRKECDAACRNTKSAKARRKARKALQKTLDEIDKAYPKPA 549
            |:.:.|....|..|.      ..|||.:|   ...|::..::.:.....|::|:..::.......
Human   257 RDQYEKMAEKNRKDAEDWFFSKTEELNRE---VATNSELVQSGKSEISELRRTMQALEIELQSQL 318

  Fly   550 KMRIKKERTHHKKSRCYTFLKLKTVSKDSRIGHLDCISGSKHTGYSRIPCHM 601
            .|:...|....:....|..          ::..:..:.||.....:::.|.|
Human   319 SMKASLEGNLAETENRYCV----------QLSQIQGLIGSVEEQLAQLRCEM 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31029NP_733347.1 DUF4788 33..228 CDD:406440
DUF4776 335..841 CDD:406413 45/279 (16%)
KRT17NP_000413.1 Head 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Filament 84..394 CDD:459643 69/377 (18%)
Coil 1A 84..120 11/35 (31%)
Peptide epitope S1, induces T-cell and keratinocyte proliferation and IFN-gamma production 102..116 1/13 (8%)
Linker 1 121..138 3/20 (15%)
Coil 1B 139..230 25/133 (19%)
Peptide epitope S2, induces T-cell proliferation and IFN-gamma production 153..167 4/31 (13%)
Linker 12 231..250 5/58 (9%)
Coil 2 251..392 21/123 (17%)
Peptide epitope S4, induces T-cell and keratinocyte proliferation and IFN-gamma production 332..346 1/23 (4%)
Tail 393..432
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.