DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31029 and KRT10

DIOPT Version :10

Sequence 1:NP_733347.1 Gene:CG31029 / 318562 FlyBaseID:FBgn0051029 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001366295.1 Gene:KRT10 / 3858 HGNCID:6413 Length:624 Species:Homo sapiens


Alignment Length:212 Identity:39/212 - (18%)
Similarity:79/212 - (37%) Gaps:55/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 YKTFEDIQPSEQPYDLTATAQQLLRDCLRKETCELDPSK--GDDEAMGDKNKDDPNVPQQCGCLG 424
            |||.:|::  .|..:||.....:|        .::|.::  .||..:..:|:.......:....|
Human   200 YKTIDDLK--NQILNLTTDNANIL--------LQIDNARLAADDFRLKYENEVALRQSVEADING 254

  Fly   425 GKPCTRCRIRKLCDNFF---KENECKIEPLPQAYPQAPSKSQPESKKVN---------QANSDES 477
                    :|::.|...   .:.|.:||.|.:.........:.|.|.:.         :.|:...
Human   255 --------LRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAPG 311

  Fly   478 LRRTQLISIFTEMRNMFGKKKGANEADVVA------EELRKECD--------------AACRNTK 522
            :..|||::   .||:.:.:....|..|..|      :||..|.|              ...||.:
Human   312 VDLTQLLN---NMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQ 373

  Fly   523 SAKARRKARKALQKTLD 539
            :.:...:::.||:::|:
Human   374 ALEIELQSQLALKQSLE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31029NP_733347.1 DUF4788 33..228 CDD:406440
DUF4776 335..841 CDD:406413 39/212 (18%)
KRT10NP_001366295.1 Head 1..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Filament 145..454 CDD:459643 39/212 (18%)
Coil 1A 146..181
Linker 1 182..202 1/1 (100%)
Coil 1B 203..294 18/108 (17%)
Linker 12 295..317 2/21 (10%)
Coil 2 318..456 14/76 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.