DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12106 and commd3

DIOPT Version :9

Sequence 1:NP_572536.1 Gene:CG12106 / 31856 FlyBaseID:FBgn0030100 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001008734.1 Gene:commd3 / 494135 ZFINID:ZDB-GENE-041219-3 Length:192 Species:Danio rerio


Alignment Length:200 Identity:45/200 - (22%)
Similarity:79/200 - (39%) Gaps:34/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LISPTVVAGLKNLGAIISLPLTKLLIANSLKLTLHPDATIAPVPELYAKNAACAKQSEYAVVTLF 84
            :::.:.|..||:......:....|:...|.....|        |||...:.:..|....|..|..
Zfish    13 ILADSNVIDLKSYAIFTEVAFNSLVSPRSESALGH--------PELKHIDQSTLKHCHTAATTFI 69

  Fly    85 ALGTKHGWDGLQLRQQLEQLNLDAAAVDELSRVYEDSRKDL--ILRQLQIGHSFPHITDIQWRIV 147
            ..|.|...|...:...||.|......||.....::.:::::  :|..:.|  ..|||||..||:.
Zfish    70 LEGVKQNADKSTISSCLEDLGFQTERVDIFYTSFQKNKQNVESLLSSIDI--CPPHITDAAWRLE 132

  Fly   148 CDVKSSTSDCSTGAACFHIN-------LGNFRQSSGERVTIVEFVCNAEELQSLINRLKE----I 201
            ..:|:|           |::       |.:....||...:.::|.|..|:||.|:.::|:    :
Zfish   133 YCIKNS-----------HVHKVNQPSYLISLNTESGGCSSKIKFNCTMEQLQDLVGKMKDAAKSV 186

  Fly   202 ERHCQ 206
            ||..|
Zfish   187 ERATQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12106NP_572536.1 Commd3 112..210 CDD:240099 25/107 (23%)
commd3NP_001008734.1 Commd3 97..191 CDD:240099 25/106 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_290EG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508761at2759
OrthoFinder 1 1.000 - - FOG0009696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106749
Panther 1 1.100 - - LDO PTHR31159
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5287
SonicParanoid 1 1.000 - - X7431
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.