DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12106 and COMMD3

DIOPT Version :9

Sequence 1:NP_572536.1 Gene:CG12106 / 31856 FlyBaseID:FBgn0030100 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_036203.1 Gene:COMMD3 / 23412 HGNCID:23332 Length:195 Species:Homo sapiens


Alignment Length:195 Identity:51/195 - (26%)
Similarity:82/195 - (42%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ISPTVVAGLKNLG---AIISLPLTKLLIA--NSLKLTLHPDATIAPVPELYAKNAACAKQSEYAV 80
            :|.:|..|.:.|.   :..|...|.||.|  .|| |....|..:...|:|...:....|....|.
Human     3 LSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSL-LDAQADEAVLDHPDLKHIDPVVLKHCHAAA 66

  Fly    81 VTLFALGTKHGWDGLQLRQQLEQLNLDAAAVDELSRVYEDSRKDLILRQLQIGHSFPHITDIQWR 145
            .|......||..|...|...||....|...::.....|::::..|.:....||.|.|||||:.||
Human    67 ATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWR 131

  Fly   146 IVCDVKSSTSDCSTGAACFHINLGNFRQSSGERVTIVEFVCNAEELQSLINRLKE----IERHCQ 206
            :...:|::........| :.:.| :.:.:.......:.|.|:.|:||.|:.:||:    :||..|
Human   132 LEYQIKTNQLHRMYRPA-YLVTL-SVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQ 194

  Fly   207  206
            Human   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12106NP_572536.1 Commd3 112..210 CDD:240099 26/99 (26%)
COMMD3NP_036203.1 Commd3 98..194 CDD:240099 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143161
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_290EG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5431
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106749
Panther 1 1.100 - - LDO PTHR31159
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5287
SonicParanoid 1 1.000 - - X7431
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.