DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12106 and commd3

DIOPT Version :9

Sequence 1:NP_572536.1 Gene:CG12106 / 31856 FlyBaseID:FBgn0030100 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_002933183.1 Gene:commd3 / 100494486 XenbaseID:XB-GENE-942203 Length:195 Species:Xenopus tropicalis


Alignment Length:194 Identity:51/194 - (26%)
Similarity:77/194 - (39%) Gaps:23/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ALISPTVVAGLKNLGAIISLPLTKLLIANSLKLTLHPDATIAPVPELYAKNAACAKQSEYAVVTL 83
            ||.:|      |:..|:|......:..|.:.:..| .||.:.|:      ..|..|....|..|.
 Frog    18 ALFTP------KSFAALIRAAFLSVSEAQAAETAL-DDAELQPI------EPALVKHCHAAATTC 69

  Fly    84 FALGTKHGWDGLQLRQQLEQLNLDAAAVDELSRVYEDSRKDLILRQLQIGHSFPHITDIQWRIVC 148
            .....||..|...|...||....|....:.....|:.:::.|......||.|.|||||:.||:..
 Frog    70 ILEAVKHNADRAGLSTFLEDCKFDKDRTELFWTEYQKNKESLETLLGSIGTSPPHITDVTWRLQY 134

  Fly   149 DVKSST--SDCSTGAACFHINLGNFRQSSGERVTIVEFVCNAEELQSLINRL----KEIERHCQ 206
            .:||:.  .....|   :.:|| ....|...:...:.|.|:.|:||.|:.:|    |.:||..|
 Frog   135 QIKSNQLYRHYRPG---YLVNL-TVESSDANQKPDISFNCSMEQLQDLLGKLRDAAKSLERTSQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12106NP_572536.1 Commd3 112..210 CDD:240099 29/101 (29%)
commd3XP_002933183.1 Commd3 98..194 CDD:240099 28/99 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508761at2759
OrthoFinder 1 1.000 - - FOG0009696
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31159
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7431
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.