DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31019 and LOC5667132

DIOPT Version :10

Sequence 1:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster
Sequence 2:XP_001688824.1 Gene:LOC5667132 / 5667132 VectorBaseID:AGAMI1_009737 Length:415 Species:Anopheles gambiae


Alignment Length:162 Identity:38/162 - (23%)
Similarity:57/162 - (35%) Gaps:50/162 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YELQHFNFSLEELVAQ--------NAEMVQSLQSKLLSRFT-EKLIE-----KRQIPPEPAERLR 60
            |:.:|   ..|::.|.        .||.||...|..||..| |..:.     |.|:.|...||.|
Mosquito   781 YDREH---GQEDIPANLSVTVRDITAEAVQQAGSMRLSHITDEDFVRTWNPVKNQVEPSKLERFR 842

  Fly    61 ASCNKTALAMYSDCQPALDHLNALFRQTFAIPDNV-LLPTDVLQSRGYTEELVGSLEQEVRSAKD 124
               ||.|..:|:|                  .||| :....:.:...|      .|.....:|:.
Mosquito   843 ---NKLAELLYTD------------------RDNVDVFSVQLKEGSPY------PLTDVHFAARS 880

  Fly   125 AVMQGAVFIASLDAEMELHRALEPCYQAEEDV 156
            |..|.......|:..:::||.     :.|:||
Mosquito   881 ATQQPYFKAVRLNGVVQMHRE-----EIEKDV 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31019NP_733391.1 Pepdidase_M14_N 55..>115 CDD:407865 12/60 (20%)
M14_AGBL4_like 198..478 CDD:349479
LOC5667132XP_001688824.1 Propep_M14 33..100 CDD:460505
M14_CP_A-B_like 128..414 CDD:349433
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.