DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31019 and LOC5667131

DIOPT Version :10

Sequence 1:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster
Sequence 2:XP_001688826.2 Gene:LOC5667131 / 5667131 VectorBaseID:AGAMI1_012854 Length:320 Species:Anopheles gambiae


Alignment Length:129 Identity:30/129 - (23%)
Similarity:53/129 - (41%) Gaps:45/129 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 RVIVVL-----CRTHSSEAPASHVCQGLIE-FLVGNHPIAAVLRDNFVFKIVPMVNPDGV----- 291
            |.:|::     .|...|...|:::...::| :....|     :.||..|.:||:|||||.     
Mosquito    72 RPLVIVEAGLRAREWISPMSANYILHEIVEHYYEFEH-----ILDNVNFLVVPLVNPDGYEFSRT 131

  Fly   292 ---------FLGNNRCNLMGQDMNRN----WH-------------IG-SEFTQPELHAVKGMLK 328
                     .:..|.|  .|.|:|||    |:             :| :.|:.||..|::.:::
Mosquito   132 TNRLWLKSRSVNGNGC--FGVDLNRNFGHLWNTVGGSNDPCSDSFVGTAAFSAPETAALRNLIQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31019NP_733391.1 Pepdidase_M14_N 55..>115 CDD:407865
M14_AGBL4_like 198..478 CDD:349479 30/129 (23%)
LOC5667131XP_001688826.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.