DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31019 and Cpa1

DIOPT Version :10

Sequence 1:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_079626.2 Gene:Cpa1 / 109697 MGIID:88478 Length:419 Species:Mus musculus


Alignment Length:171 Identity:41/171 - (23%)
Similarity:63/171 - (36%) Gaps:60/171 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 GNHPIAAVLRDNFVFKIVPMVNPDGVFLGNNRCNLM--------------GQDMNRNWHIGSEFT 316
            |..|....:.||....:..:.|||| |:..::.|.|              |.|.||||       
Mouse   201 GQEPTLTAILDNMDIFLEIVTNPDG-FVYTHKTNRMWRKTRSHTEGSLCVGVDPNRNW------- 257

  Fly   317 QPELHAVKGMLKELDN--SDVSRG----IETDLIGII-FVCSYN-----ISFQTY---------- 359
                .|..||.....|  |:..||    .|.::..|: ||.|:.     ||..:|          
Mouse   258 ----DAAFGMPGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGY 318

  Fly   360 ---------QIDFVID--LHANSSMHGC-FIYGNTYEDVYR 388
                     ::|.:..  :.|.:|:||. |.||:..:.:|:
Mouse   319 TSEPAPDKEELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31019NP_733391.1 Pepdidase_M14_N 55..>115 CDD:407865
M14_AGBL4_like 198..478 CDD:349479 41/171 (24%)
Cpa1NP_079626.2 Propep_M14 26..100 CDD:460505
M14_CPA 117..417 CDD:349442 41/171 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.