DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and MIX17

DIOPT Version :9

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_013715.1 Gene:MIX17 / 855014 SGDID:S000004604 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:37/148 - (25%)
Similarity:57/148 - (38%) Gaps:44/148 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRKQRSASVKAGSTNYM----------PAVVPTVTNSEMVFKEAAAHAVGVAAGSVVGHAIGSGI 56
            |.:.||||..|...:..          |......|....:|.:.|:.|.|||.||.:||.:|:||
Yeast    16 PTQTRSASTMAAPVHPQQQQQPNAYSHPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGI 80

  Fly    57 TGLF-----------------------RRRDQQPHHSDLVEEGPCAKEMKEFLKC-TEDNDDLSV 97
            ||:|                       .:.|||...:       |..:.:.|.:| .|:|.:..:
Yeast    81 TGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRT-------CEIDARNFTRCLDENNGNFQI 138

  Fly    98 CKEFNDAVRRCH---RQY 112
            |..:...::.|.   |||
Yeast   139 CDYYLQQLKACQEAARQY 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 7/36 (19%)
MIX17NP_013715.1 CHCH 118..152 CDD:399611 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1607
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.