powered by:
Protein Alignment CG31008 and AT5G64400
DIOPT Version :9
Sequence 1: | NP_733411.1 |
Gene: | CG31008 / 318554 |
FlyBaseID: | FBgn0051008 |
Length: | 114 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001032137.1 |
Gene: | AT5G64400 / 836561 |
AraportID: | AT5G64400 |
Length: | 162 |
Species: | Arabidopsis thaliana |
Alignment Length: | 38 |
Identity: | 11/38 - (28%) |
Similarity: | 16/38 - (42%) |
Gaps: | 6/38 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 PRKQRSASVKAGSTNYMPAVVPTVTNSEMVFKEAAAHA 39
||..:..:|:|.|.:..|| .|.|:......||
plant 76 PRTIQHEAVEAASASAAPA------GSAMLSSTCDIHA 107
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31008 | NP_733411.1 |
CHCH |
78..111 |
CDD:284221 |
|
AT5G64400 | NP_001032137.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4090 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13523 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.