DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and AT5G09570

DIOPT Version :9

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_196519.1 Gene:AT5G09570 / 830816 AraportID:AT5G09570 Length:139 Species:Arabidopsis thaliana


Alignment Length:122 Identity:25/122 - (20%)
Similarity:43/122 - (35%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRKQRSASVKAGSTNYMPAVVPTVTNSEMVFKEAAAHAVGVA--AGSVVGHAIGSGITG--LFRR 62
            |...||...::.:....||.....:....:....|:...|:|  .|:..||.:...:.|  .|: 
plant    17 PAAARSPPPQSVNRAPPPATAQPSSGGSFLGNIGASITEGLAWGTGTAFGHRVVDSVMGPRTFK- 80

  Fly    63 RDQQPHHSDLVEEGP--------CAKEMKEFLKCTED-NDDLSVCKEFNDAVRRCHR 110
                  |..:|.:.|        |....|.|..|... ..|:|.|:.:.|.:..|.:
plant    81 ------HETVVSQVPSAANTMTACDIHSKAFQDCVNHFGSDISKCQFYMDMLSECKK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 9/34 (26%)
AT5G09570NP_196519.1 CHCH 98..132 CDD:399611 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.