DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and gpat3

DIOPT Version :9

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001008432.1 Gene:gpat3 / 493261 XenbaseID:XB-GENE-993435 Length:154 Species:Xenopus tropicalis


Alignment Length:151 Identity:46/151 - (30%)
Similarity:61/151 - (40%) Gaps:46/151 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRKQRSASVK-AGSTNYMPAVVPT----------VTNSEMVFKEAAA-------------HAVG 41
            |||..||.:.: |...:..||:.|.          |..:......|||             .|.|
 Frog     1 MPRGSRSRTSRVAPPASRAPAMRPAPPPAAHPPAPVAQAPSALGPAAAAPRQPGLMAQMATTAAG 65

  Fly    42 VAAGSVVGHAIGSGITGLF--------RRRD-----------QQPHHSDLVEEGPCAKEMKEFLK 87
            ||.||.|||.||..|||.|        .|.|           ||...|...   ||..|||:||:
 Frog    66 VAVGSAVGHTIGHAITGGFGGGSSAEPARADITYQEPAQPMYQQQQQSQYT---PCQYEMKQFLE 127

  Fly    88 CTEDNDDLSVCKEFNDAVRRC 108
            |.::..||.:|:.|.:.:::|
 Frog   128 CAQNQSDLKLCEGFGEVLKQC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 12/31 (39%)
gpat3NP_001008432.1 CHCH 118..151 CDD:310983 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.