DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and SPAC6C3.02c

DIOPT Version :9

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_593716.1 Gene:SPAC6C3.02c / 2543292 PomBaseID:SPAC6C3.02c Length:172 Species:Schizosaccharomyces pombe


Alignment Length:170 Identity:36/170 - (21%)
Similarity:57/170 - (33%) Gaps:58/170 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRK-------QRSASVKAGST----------------NYMPAVVPTVT---NSEMVFKEAAAHA 39
            |||:       :|:|..::.||                ....|..||..   :|...|....:.|
pombe     1 MPRRRSAAPPPRRAAPARSASTAAALPPRTMAPPPAPSRVQQAPPPTAVQGGSSPGFFGNLVSTA 65

  Fly    40 VGVAAGSVVGHAIGSGITGLFRRRDQ----------QPHHSDLVEE------------------- 75
            .||..||.:||.:||.|||.|.....          |..:|:.|.|                   
pombe    66 AGVGIGSAIGHTVGSVITGGFSGSGSNNAPADTSVPQSSYSNSVPEAAYGSAPPSTFASSAISEE 130

  Fly    76 --GPCAKEMKEFLKCTEDNDDLSVCKEFNDAVRRCHRQYN 113
              ..|..:.|.|..|..:: :.|.|..:.:.::.|...::
pombe   131 AKNACKGDAKMFADCINEH-EFSQCSYYLEQLKACQAMWS 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 7/32 (22%)
SPAC6C3.02cNP_593716.1 COG3416 <22..142 CDD:225950 25/119 (21%)
CHCH 135..165 CDD:284221 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.