DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and Chchd10

DIOPT Version :9

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_780538.2 Gene:Chchd10 / 103172 MGIID:2143558 Length:138 Species:Mus musculus


Alignment Length:133 Identity:42/133 - (31%)
Similarity:66/133 - (49%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRKQRSASVKAGSTNYMP---------AVVPTVTNSEMVFKEAAAHAVGVAAGSVVGHAIGSGI 56
            |||..|||:.:..|....|         |..|.......:..:.|:.|.|||.||.|||.:||.:
Mouse     1 MPRGSRSAAARPVSRPAPPPAHPPPSAAAPAPAAPGQPGLMAQMASTAAGVAVGSAVGHVMGSAL 65

  Fly    57 TGLFRRRDQQPHH-----------SDLVEEGPCAKEMKEFLKCTEDNDDLSVCKEFNDAVRRCHR 110
            |..|...:.:|..           |..::.|||:.|:|:||.|:....||::|:.|::|:::|  
Mouse    66 TSAFSGGNSEPAQPAVQQAPARPASHPLQMGPCSYEIKQFLDCSTTQSDLTLCEGFSEALKQC-- 128

  Fly   111 QYN 113
            :||
Mouse   129 KYN 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 12/32 (38%)
Chchd10NP_780538.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.