DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and MIX17

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_013715.1 Gene:MIX17 / 855014 SGDID:S000004604 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:59/172 - (34%)
Similarity:92/172 - (53%) Gaps:25/172 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RSTGSMRRQSSRSSHVFATKPSR-GSSKDLPAVQQPKKESLPAA---APAASAATSTETKGPSTA 70
            ||.|| .|..|||      :|:: .|:..:.|...|:::..|.|   .|||.|    :|:.|.  
Yeast     3 RSRGS-SRPISRS------RPTQTRSASTMAAPVHPQQQQQPNAYSHPPAAGA----QTRQPG-- 54

  Fly    71 DRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPKPQLVE 135
             .|..||:||||||.||.:||.:|||:||||.|.|..:...||.||  ::|.::.|:....||  
Yeast    55 -MFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQQQQ--NMANTSGQTQTDQQL-- 114

  Fly   136 DGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCR---RRY 174
            ...|..:.|.|.:|.::|:.:..:|..:.:.::.|:   |:|
Yeast   115 GRTCEIDARNFTRCLDENNGNFQICDYYLQQLKACQEAARQY 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 7/36 (19%)
MIX17NP_013715.1 CHCH 118..152 CDD:399611 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1607
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.