DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and AT5G64400

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001032137.1 Gene:AT5G64400 / 836561 AraportID:AT5G64400 Length:162 Species:Arabidopsis thaliana


Alignment Length:166 Identity:41/166 - (24%)
Similarity:55/166 - (33%) Gaps:50/166 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETKGPS 68
            :||.|.||....|..::||                ||.|...:...||.|.|:...         
plant     3 RRSSGGRSAPRPRPAAARS----------------PAPQPVHRAPPPAPAQASGGG--------- 42

  Fly    69 TADRFKDMATT-AAGVA--AGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPK 130
             ...|..:.:| |.|:|  .||||.|.....:.|           ....|.|...||||| :.|.
plant    43 -GGMFSGIGSTIAQGMAFGTGSAVAHRAVDSVMG-----------PRTIQHEAVEAASAS-AAPA 94

  Fly   131 PQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEA 166
            ...:....|....:.|        .|:|. |.|:.|
plant    95 GSAMLSSTCDIHAKAF--------QDVSF-KSFSHA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 7/28 (25%)
AT5G64400NP_001032137.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.