DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and AT5G09570

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_196519.1 Gene:AT5G09570 / 830816 AraportID:AT5G09570 Length:139 Species:Arabidopsis thaliana


Alignment Length:172 Identity:40/172 - (23%)
Similarity:64/172 - (37%) Gaps:41/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETK 65
            |||..|.|            |||:    :|||.:     |.:.|..:|:..|.|.|:|..|:   
plant     1 MPRGSSGG------------RSSY----RPSRPA-----AARSPPPQSVNRAPPPATAQPSS--- 41

  Fly    66 GPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPK 130
            |.|.........|.......|:|.||.|...:.|         |...:.:...|...||:.::. 
plant    42 GGSFLGNIGASITEGLAWGTGTAFGHRVVDSVMG---------PRTFKHETVVSQVPSAANTMT- 96

  Fly   131 PQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCRR 172
                   .|....:.|..|.....||:|.|:.:.:.:.:|::
plant    97 -------ACDIHSKAFQDCVNHFGSDISKCQFYMDMLSECKK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 8/34 (24%)
AT5G09570NP_196519.1 CHCH 98..132 CDD:399611 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.