DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and Zbed5

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_898911.2 Gene:Zbed5 / 71970 MGIID:1919220 Length:756 Species:Mus musculus


Alignment Length:175 Identity:65/175 - (37%)
Similarity:86/175 - (49%) Gaps:43/175 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RGSSKDLPAVQQPKKESLPAAAPAA---SAATSTETKGPSTADR----FKDMATTAAGVAAGSAV 89
            |.|...|.|.:.|:..:.|..||||   :||..:....|:.|.|    ...|||||||||.||||
Mouse     8 RTSRVTLLAGRAPQMRAAPRRAPAAQPPAAAAPSAVGSPAAAPRQPGLMAQMATTAAGVAVGSAV 72

  Fly    90 GHAVGAGLTGMFQGRGQAAPAK-----EQPQQEGSLAASASQSVPKPQLVEDGPCAFELRQFLKC 149
            ||.:|..:||.|.|.|.|.|||     ::||   .......||.        |||:.|::|||:|
Mouse    73 GHTLGHAITGGFSGGGSAEPAKPDITYQEPQ---GAQLQNQQSF--------GPCSLEIKQFLEC 126

  Fly   150 TEDNSSDLSVCKEFNEAMQQC-------------------RRRYN 175
            .: |.||:.:|:.|||.::||                   ||:||
Mouse   127 AQ-NQSDVKLCEGFNEVLRQCRIANVDHPRPVDHGERNVKRRKYN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 16/52 (31%)
Zbed5NP_898911.2 CHCH 116..147 CDD:284221 14/31 (45%)
DUF4371 <335..407 CDD:290989
Dimer_Tnp_hAT 671..736 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.