DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and CHCHD10

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001288268.1 Gene:CHCHD10 / 400916 HGNCID:15559 Length:149 Species:Homo sapiens


Alignment Length:172 Identity:68/172 - (39%)
Similarity:90/172 - (52%) Gaps:33/172 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETK 65
            |||    |.||..|  |.:||        |:..|:.  |....|...:.||.||:.......:  
Human     1 MPR----GSRSAAS--RPASR--------PAAPSAH--PPAHPPPSAAAPAPAPSGQPGLMAQ-- 47

  Fly    66 GPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVP- 129
                      |||||||||.||||||.:|:.|||.|.| |.:.|:  ||..:..||.......| 
Human    48 ----------MATTAAGVAVGSAVGHVMGSALTGAFSG-GSSEPS--QPAVQQPLALYPQAPTPA 99

  Fly   130 KPQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCR 171
            .||.::.||||:|:||||.|: ...||||:|:.|:||::||:
Human   100 APQPLQMGPCAYEIRQFLDCS-TTQSDLSLCEGFSEALKQCK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 18/33 (55%)
CHCHD10NP_001288268.1 DUF2076 <40..>88 CDD:331414 25/62 (40%)
CHCH 109..140 CDD:310983 17/31 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142056
Domainoid 1 1.000 44 1.000 Domainoid score I12296
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.