DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and chchd10

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_957078.1 Gene:chchd10 / 393757 ZFINID:ZDB-GENE-040426-1753 Length:143 Species:Danio rerio


Alignment Length:146 Identity:59/146 - (40%)
Similarity:76/146 - (52%) Gaps:18/146 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SRGS-SKDLPAVQQPKKESLPAAAPAASA----ATSTETKGPSTADRFKDMATTAAGVAAGSAVG 90
            :||| |:..||   |.....|:.|||.:|    |.:.....|........|||||||||.|||||
Zfish     2 ARGSRSRPSPA---PASAPAPSYAPAPAAPPPMAVAPAAAQPKQPGLMAQMATTAAGVAVGSAVG 63

  Fly    91 HAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPKPQLVEDGPCAFELRQFLKCTEDNSS 155
            |.:|:.:||.|.|...:...|..|..:.......|||         |||.||:||||.|. ...:
Zfish    64 HVMGSAITGAFSGGSSSEAPKPAPTYQEPSRLPPSQS---------GPCLFEVRQFLDCA-TTQA 118

  Fly   156 DLSVCKEFNEAMQQCR 171
            |||:|:.||||::||:
Zfish   119 DLSLCEGFNEALKQCK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 18/33 (55%)
chchd10NP_957078.1 CHCH 103..134 CDD:284221 17/31 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.