DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and chchd2

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_957061.1 Gene:chchd2 / 393740 ZFINID:ZDB-GENE-040426-1737 Length:168 Species:Danio rerio


Alignment Length:180 Identity:61/180 - (33%)
Similarity:89/180 - (49%) Gaps:27/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETK 65
            |||         || |.::||.|     .||..|...:.....|:..:...|.|..||.......
Zfish     1 MPR---------GS-RSRTSRMS-----PPSYSSPAPMARAAPPRSYAPAPAPPPPSAVAPPAAA 50

  Fly    66 GPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAK-----EQPQQEGSLAASAS 125
            .|.....|..||:||||||.||||||.:|..:||.|.|.|.:..|:     ::|.|..::.....
Zfish    51 APRQPGMFAQMASTAAGVAVGSAVGHTIGHAMTGGFGGGGHSEAARPDVTYQEPYQGQAMYPPQQ 115

  Fly   126 QSVP----KPQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCR 171
            |..|    .||  :..||::|::||::|.: :.|||.:|:.|:|.::|||
Zfish   116 QQQPMYQQDPQ--QQNPCSYEMKQFIECAQ-SQSDLKLCEGFSEVLKQCR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 14/33 (42%)
chchd2NP_957061.1 CHCH 131..162 CDD:284221 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.