DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and CG31008

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster


Alignment Length:176 Identity:67/176 - (38%)
Similarity:90/176 - (51%) Gaps:62/176 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETK 65
            |||::               ||:.|.|     ||:..:|||              ....|::|..
  Fly     1 MPRKQ---------------RSASVKA-----GSTNYMPAV--------------VPTVTNSEMV 31

  Fly    66 GPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPK 130
                   ||:.|..|.||||||.||||:|:|:||:|:.|.|      ||...             
  Fly    32 -------FKEAAAHAVGVAAGSVVGHAIGSGITGLFRRRDQ------QPHHS------------- 70

  Fly   131 PQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCRRRYNV 176
             .|||:||||.|:::|||||||| .|||||||||:|:::|.|:||:
  Fly    71 -DLVEEGPCAKEMKEFLKCTEDN-DDLSVCKEFNDAVRRCHRQYNI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 22/33 (67%)
CG31008NP_733411.1 CHCH 78..111 CDD:284221 22/33 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I19348
eggNOG 1 0.900 - - E1_KOG4090
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1607
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019498
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.