DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and Chchd2

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001015019.1 Gene:Chchd2 / 316643 RGDID:1309819 Length:154 Species:Rattus norvegicus


Alignment Length:149 Identity:59/149 - (39%)
Similarity:79/149 - (53%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SRGSSKDLPAVQQPKKES----LPAAAPAASAATSTETKGPSTADR----FKDMATTAAGVAAGS 87
            ||.|....||.:.|:..:    .|||.|.|:||..:....|:.|.|    ...|||||||||.||
  Rat     7 SRTSRVTPPASRAPQMRAAPRRAPAAQPPATAAAPSAVGSPAAAPRQPGLMAQMATTAAGVAVGS 71

  Fly    88 AVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPKPQLVEDGPCAFELRQFLKCTED 152
            ||||.:|..:||.|.|...|.||:.      .:.....|..|.......|||:.|::|||:|.: 
  Rat    72 AVGHTLGHAITGGFSGGANAEPARP------DITYQEPQGAPLQNQQSFGPCSLEIKQFLECAQ- 129

  Fly   153 NSSDLSVCKEFNEAMQQCR 171
            |.||:.:|:.|||.::|||
  Rat   130 NQSDVKLCEGFNEVLRQCR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 16/33 (48%)
Chchd2NP_001015019.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.