DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and har-1

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_497826.1 Gene:har-1 / 175529 WormBaseID:WBGene00007630 Length:154 Species:Caenorhabditis elegans


Alignment Length:177 Identity:68/177 - (38%)
Similarity:90/177 - (50%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRQRSEGPRSTGSMR---RQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATST 62
            |.|:|:..|..:..:|   |.:::||  ||..|.|      ||...|.... |||.....|....
 Worm     1 MVRRRTASPSPSAPVRSAPRPAAQSS--FAAPPPR------PAAAAPAYHP-PAAPTPMGAPMGA 56

  Fly    63 ETKGPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQS 127
            .::||..   .|.||.||.|||.|||||||||    |||.| |.::.|::.|     .||:|...
 Worm    57 PSQGPGL---MKQMAATAGGVAIGSAVGHAVG----GMFTG-GGSSHAEQAP-----AAAAAPAG 108

  Fly   128 VPKPQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCRRRY 174
            .|:...... ||.||.|||:.|.: |.||:|:|..||:..:||:.||
 Worm   109 APQASGYSQ-PCEFEWRQFVDCAQ-NQSDVSLCNGFNDIFKQCKARY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 16/33 (48%)
har-1NP_497826.1 COG3416 <7..>90 CDD:225950 38/98 (39%)
CHCH 119..152 CDD:284221 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.