DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and Chchd10

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_780538.2 Gene:Chchd10 / 103172 MGIID:2143558 Length:138 Species:Mus musculus


Alignment Length:155 Identity:58/155 - (37%)
Similarity:82/155 - (52%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETKGPSTADRFKDMATTAAGVAA 85
            |.|...|.:|   .|:..|....|...   |||||.:|        |........||:||||||.
Mouse     3 RGSRSAAARP---VSRPAPPPAHPPPS---AAAPAPAA--------PGQPGLMAQMASTAAGVAV 53

  Fly    86 GSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPKPQLVEDGPCAFELRQFLKCT 150
            ||||||.:|:.||..|.| |.:.||:...||        :.:.|....::.|||::|::|||.|:
Mouse    54 GSAVGHVMGSALTSAFSG-GNSEPAQPAVQQ--------APARPASHPLQMGPCSYEIKQFLDCS 109

  Fly   151 EDNSSDLSVCKEFNEAMQQCRRRYN 175
             ...|||::|:.|:||::||  :||
Mouse   110 -TTQSDLTLCEGFSEALKQC--KYN 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 15/33 (45%)
Chchd10NP_780538.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54220
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.840

Return to query results.
Submit another query.