DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and chchd10

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_002940705.2 Gene:chchd10 / 100379881 XenbaseID:XB-GENE-5962008 Length:147 Species:Xenopus tropicalis


Alignment Length:169 Identity:63/169 - (37%)
Similarity:85/169 - (50%) Gaps:38/169 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETKGPST 69
            ||..||:.         |||..:..|:       ||...|...:| |:|||.|       :||..
 Frog     6 RSAPPRTA---------SSHASSPAPA-------PAPANPPPSAL-ASAPAPS-------QGPGL 46

  Fly    70 ADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQ--AAPAKEQPQQEGSLAASASQSVPKPQ 132
               ...|||||||||.||||||.:|..|||.|.|...  |.|..::||:        |.:||:..
 Frog    47 ---MAQMATTAAGVAVGSAVGHVLGGALTGAFSGSSSEPAKPVAQEPQR--------SSAVPQQI 100

  Fly   133 LVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCR 171
            ....|||.:|::|||.|. ...|||::|:.|:|.::||:
 Frog   101 PPHHGPCHYEMKQFLDCA-TTQSDLTLCEGFSEVLKQCK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 14/33 (42%)
chchd10XP_002940705.2 DUF2076 <35..>90 CDD:421358 30/64 (47%)
CHCH 107..140 CDD:399611 14/33 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13523
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.