DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gskt and YGK3

DIOPT Version :9

Sequence 1:NP_733426.1 Gene:gskt / 318552 FlyBaseID:FBgn0046332 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_014513.1 Gene:YGK3 / 853992 SGDID:S000005488 Length:375 Species:Saccharomyces cerevisiae


Alignment Length:373 Identity:130/373 - (34%)
Similarity:211/373 - (56%) Gaps:40/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NKVTTVVATNAFGADVM-------SEISYTDAKVVGNGSFGVVFQAKMVPSNEM-----VAIKKV 64
            |::|.:...:.|..|::       |::...:.|.:|:||||.|.|: ::.||.:     .|||:|
Yeast    13 NRMTKLEDEHYFIDDIVSIKNRQKSKMYVREGKRIGHGSFGTVTQS-ILSSNSIEWLGPYAIKRV 76

  Fly    65 LQDRRFKNRELQIMRKLRHDNIITLKWFFFSSGEKRDEVYL---NLVMEFLPETLYKVERQYARA 126
            ::..:.::.||:|::.:||.|::||::||.|....:|..:|   |.|||::|:||.....:|...
Yeast    77 VKSPKVQSLELEILQNIRHPNLVTLEFFFESHCTTKDGGHLYQKNFVMEYIPQTLSSEIHEYFDN 141

  Fly   127 KQTLPVNFVRLYMYQLLRSMGYLHSLGFCHRDIKPQNMLLDSETGVLKLCDFGSAKQLISGEPNV 191
            ...:|...::||.:|:||::..|||:..||.|:||.|:|:...:|:.|:||||||::|.......
Yeast   142 GSKMPTKHIKLYTFQILRALLTLHSMSICHGDLKPSNILIIPSSGIAKVCDFGSAQRLDDNTELK 206

  Fly   192 SYICSRYYRAPELIFGSTDYTTKIDMWSAGCVMSELLLGQLIFPGDSGVDQIVEIVKVMG----- 251
            :|.|||:||||||:..|.||||:||:||.||::.|::.||.:|.|||...|:.||.|::|     
Yeast   207 TYFCSRFYRAPELLLNSKDYTTQIDIWSLGCIIGEMIKGQPLFKGDSANSQLEEIAKLLGRFPKS 271

  Fly   252 -TPTSEQLHDM--NPHYKQFKLPELKPHPWSKVFRIRTPAEAIDLVSKMLIYSPNARVSPLMGCA 313
             ...|::|.|.  :..:|:|    :...|..:.|       .::.:.|:|.|....|.......|
Yeast   272 SIKNSQELQDSLNDQKFKKF----MHWFPSIEFF-------DVEFLLKVLTYDATERCDARQLMA 325

  Fly   314 HPFFDELRQDPHQQLPNGRS----LPPLFNFTDYEKTIEPDTMPLLLP 357
            |.|||.||.:.: .||.|.|    ||.||||:..||....:...|::|
Yeast   326 HEFFDALRNETY-FLPRGSSMPVHLPDLFNFSASEKRALGEYYNLIVP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsktNP_733426.1 STKc_GSK3 30..320 CDD:271039 109/305 (36%)
S_TKc 33..317 CDD:214567 106/299 (35%)
YGK3NP_014513.1 STKc_GSK3 35..332 CDD:271039 110/308 (36%)
S_TKc 44..329 CDD:214567 106/296 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.